KEGG   Bacillus subtilis subsp. subtilis 168: BSU14770Help
Entry
BSU14770          CDS       T00010                                 

Gene name
bipA
Definition
(RefSeq) GTP-binding protein TypA/BipA
  KO
K06207  GTP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU14770 (bipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_C GTP_EFTU_D2 EFG_II MMR_HSR1 FeoB_N Arf SRPRB Septin Roc Dynamin_N Peptidase_U32_C Ras DUF1987 GTP_EFTU_D4
Motif
Other DBs
NCBI-GeneID: 935966
NCBI-ProteinID: NP_389360
Pasteur: BG13344
BSORF: BG13344
UniProt: O07631
Position
1546121..1547959
Genome map
AA seq 612 aa AA seqDB search
MKLRNDLRNIAIIAHVDHGKTTLVDQLLHQAGTFRANEQVAERAMDSNDLERERGITILA
KNTAINYKDTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGCMPQTRFVLKKALE
QNLNPVVVVNKIDRDFARPEEVIDEVLDLFIELDANEEQLEFPVVYASAINGTASLDPKQ
QDENMEALYETIIKHVPAPVDNAEEPLQFQVALLDYNDYVGRIGIGRVFRGTMKVGQQVS
LMKLDGTAKSFRVTKIFGFQGLKRVEIEEAKAGDLVAVSGMEDINVGETVCPVDHQDPLP
VLRIDEPTLQMTFVVNNSPFAGREGKYVTARKIEERLQSQLQTDVSLRVEPTASPDAWVV
SGRGELHLSILIENMRREGYELQVSKPEVIIKEIDGVRCEPVERVQIDVPEEHTGSVMES
MGARKGEMVDMINNGNGQVRLIFTVPSRGLIGYSTEFLSLTRGFGILNHTFDSYQPMQAG
QVGGRRQGVLVSMENGKATSYGIQGIEDRGVIFVEPGTEVYEGMIVGEHNRDNDLVVNVS
KMKQQTNVRSATKDQTTTIKKARIMSLEESLEYLNEDEYCEVTPESIRLRKKILNKNERE
KAAKKKKTAGLS
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacttcgaaatgatcttcgcaacatcgcgattattgcccacgttgaccatgggaaa
acgactctagtcgatcagcttttacatcaggctggtacgttccgtgccaacgaacaggtt
gctgaacgcgcaatggactctaatgatcttgaacgcgaacgcggcattacaatattggcg
aaaaatactgcgattaactataaagatacacgtatcaatattttggacacccctggacat
gcagactttgggggagaagtagaacggattatgaaaatggttgacggcgtagtgcttgtc
gttgacgcatatgaaggctgtatgcctcaaactcgttttgttctgaaaaaagctcttgag
caaaacctgaaccctgttgttgttgtaaacaaaattgaccgtgactttgctcgtccagag
gaagttatcgatgaagttctggatctgttcattgagcttgatgccaatgaagagcagctc
gagttcccagtggtatatgcttccgcgattaatggaacagcgagtcttgatccgaaacaa
caggatgaaaacatggaagctttatatgaaaccattattaagcatgttccggcacctgtt
gataatgcagaggagccgcttcaattccaagttgcccttcttgactacaacgactatgta
ggccgtatcggaatcggacgcgtattccgcggcacaatgaaagtcggacagcaggtttct
cttatgaagcttgacggaacggcaaagtcattccgtgttacaaagatttttggtttccaa
ggcttaaagcgtgtggaaattgaagaagcaaaagcgggagacctcgttgcggtttccggg
atggaagatatcaacgttggtgaaacggtatgtcctgtagaccatcaagatccgcttccg
gtccttcgcattgatgagccgacacttcaaatgacatttgtcgtgaataacagtccgttt
gcaggccgtgaaggcaaatatgtaacggcccgcaaaatcgaagagcgtcttcaatcacag
cttcagacggatgtgagcttgcgtgttgagccaacagcttctcctgatgcttgggttgtt
tcaggacgcggtgagctgcacttgtcaattttaattgaaaatatgcgtcgtgagggctat
gagcttcaagtgtcaaaacctgaagttattatcaaagaaatcgacggcgtacgctgtgag
cctgttgaacgtgtgcaaattgatgttcctgaagagcatactggctctgtaatggaatca
atgggtgcccgcaaaggcgaaatggttgatatgatcaacaacggaaacggccaagtccgt
ctcatctttacagttccttcccgcggattgatcggttactctacagaattcctatcatta
acacgcggattcggtattttgaaccatacgtttgacagctaccagccgatgcaggcaggc
caagtcggcggacgccgtcaaggtgtacttgtgtcaatggaaaacggaaaagcaacatca
tacggtattcaaggaattgaagaccgcggtgtcatcttcgttgagccgggtactgaagta
tacgaaggaatgatcgttggagagcataaccgtgacaacgaccttgttgttaacgtcagc
aaaatgaaacagcaaacaaacgtccgttctgcgacaaaggatcagacaactacaattaaa
aaagcgcgcatcatgtctcttgaggagtctctagagtacttaaacgaagatgaatattgt
gaagtaacacctgaatccatccgtttaagaaagaagatcctcaataagaacgaacgtgaa
aaagcagctaaaaagaaaaaaacagcaggattgtcttaa

DBGET integrated database retrieval system