KEGG   Bacillus subtilis subsp. subtilis 168: BSU14780Help
Entry
BSU14780          CDS       T00010                                 

Gene name
ylaH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YlaH DUF3094 OST3_OST6 Popeye
Motif
Other DBs
NCBI-GeneID: 935937
NCBI-ProteinID: NP_389361
Pasteur: BG13345
BSORF: BG13345
UniProt: O07632
Position
1548016..1548333
Genome map
AA seq 105 aa AA seqDB search
MNDVSERLSFFAALYQVDRQPAAGMWLLYGTIFVLAVIVFKLGFAKRLPVLKSAVVYVFL
ALGCTVLTFLGVFLPVAEGLVVAALILIIYKIRLYQSKKGQSAKS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgacgtaagcgaacgcctgtcgttcttcgccgctctatatcaagtagaccggcag
cctgcggcaggcatgtggctgctgtacggcacgatttttgtgttggccgttattgtattt
aagcttggatttgctaaacggcttcctgtattaaaatctgcagtggtgtatgtatttttg
gctttgggctgcactgttttgacttttttaggggtgtttttgcccgtggcagaaggattg
gtcgtcgctgcgctgattttaatcatttacaaaatccggctgtatcagtcgaaaaaagga
cagtctgcaaaatcataa

DBGET integrated database retrieval system