KEGG   Bacillus subtilis subsp. subtilis 168: BSU14790Help
Entry
BSU14790          CDS       T00010                                 

Gene name
ylaI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2197 zf-SNAP50_C Cytochrom_c3_2 zf-CHY FdhE zf-C3HC4_3 Cytochrome_C7
Motif
Other DBs
NCBI-GeneID: 935943
NCBI-ProteinID: NP_389362
Pasteur: BG13346
BSORF: BG13346
UniProt: O07633
Position
complement(1548389..1548598)
Genome map
AA seq 69 aa AA seqDB search
MMRVKCSICDKIETIDDDTLIAKRLRNRPIHTYMCQECHDRIAKKTEERLKTGKFTFHPG
QQKKEKVKK
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgatgagggtcaaatgttctatttgcgataaaattgaaacaattgatgatgataccctg
atcgcgaaacggcttcgaaaccgcccgatccatacatatatgtgccaggaatgccacgat
cggattgccaaaaaaacagaggaacggctgaaaacgggaaaatttacttttcacccggga
cagcagaaaaaagaaaaagtcaaaaaataa

DBGET integrated database retrieval system