KEGG   Bacillus subtilis subsp. subtilis 168: BSU14800Help
Entry
BSU14800          CDS       T00010                                 

Gene name
ylaJ
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-GeneID: 935926
NCBI-ProteinID: NP_389363
Pasteur: BG13347
BSORF: BG13347
UniProt: O07634
Position
complement(1548681..1549310)
Genome map
AA seq 209 aa AA seqDB search
MRILFIIIQLTLILSACAYQQGKQGQNVEKESTRQQETKPIHVKDTTQETKDNGTRTDIA
KHLVSVAEKNPDVKDATAVVLGGYAVVGIDVDDTLDRSKVETIKYSVAQALKNDRYGANA
VVIADPDTVSRLREMSREISEGHPVTGILDELAAIVGRVLPEVPNDVIDNEDEPQTKQQN
DQLNRKQQQEMEKEQNDQSDHHMKKNNND
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaattcttttcattatcatacagctgacacttatcctgtccgcttgtgcctatcaa
caaggaaaacagggccagaatgttgaaaaagaatcaacaagacagcaggagactaaaccg
attcacgtaaaggacacaactcaagaaacaaaagacaatggaacaagaacggatattgcc
aagcatcttgtcagcgttgctgaaaaaaaccccgacgtcaaggatgcaacagccgttgtg
ctgggaggctatgctgttgttgggattgatgtcgatgatactttggacagaagcaaagtg
gaaaccattaaatattctgtagctcaggcgctaaagaatgatcgatatggcgccaacgca
gtagtcattgctgatcccgatacggtcagccgccttcgcgaaatgagcagagaaatcagc
gagggccatccggtaacaggtatactggatgaattagctgcaattgtcggccgagtgctt
cccgaagtgcctaacgatgtgattgacaatgaagatgaaccgcaaacaaagcagcaaaat
gaccaattaaatagaaaacagcaacaggaaatggagaaggaacaaaacgatcaatctgat
catcatatgaaaaagaacaacaatgactaa

DBGET integrated database retrieval system