KEGG   Bacillus subtilis subsp. subtilis 168: BSU14810Help
Entry
BSU14810          CDS       T00010                                 

Gene name
ylaK
Definition
(RefSeq) hypothetical protein
  KO
K07175  PhoH-like ATPase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BSU14810 (ylaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoH PIN_4 AAA_30 AAA_19 AAA_22 Viral_helicase1 AAA_11 ABC_tran DUF4350 IstB_IS21 AAA_25 AAA_7
Motif
Other DBs
NCBI-GeneID: 935933
NCBI-ProteinID: NP_389364
Pasteur: BG13348
BSORF: BG13348
UniProt: O07635
Position
1549465..1550793
Genome map
AA seq 442 aa AA seqDB search
MSKIYVLDTNVLLQDPNAIFSFEENEVVIPAVVLEEVDSKKRYMDEVGRNARHVSKLIDA
LRQKGRLHEHVPLDTGGTLRIELNHRSFHQLQEIFIEKTNDNRILAVAKNLSLEEETKEN
GRPVILVSKDVLVRVKADAIGLLAEDFLNDRVVDNDEMYSGYKDLYISQQLFSSFYGKNQ
ISVNDVKQHAFYPNQFALMKDELGGSSSAVGIADKTGTVLKRLVFDDEHIWGIRPKNVQQ
TMALELLLREDIPLVTLIGKAGTGKTLLALAAGLLQTEDLGIYKKLVVARPIVPVGKDIG
YLPGEKEEKLKPWMQPIFDNLEFLFNAKKPGELDAILAGIGSIQVEALTYIRGRSIPDQF
IIIDEAQNLTRHEVKTLLTRVGEGSKIVLMGDPEQIDHPYLDSLNNGLAYVVERFKGQPI
SGSVKLLKGERSGLAQLAADLL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaaatttatgtgttagatacgaatgtgttattacaggatcctaacgcgatattt
tcttttgaagaaaatgaggttgtcatccctgctgtcgttttagaagaggttgattcaaaa
aaacggtatatggacgaagttgggaggaatgcaaggcacgtatctaagctaatcgatgcg
ctaagacaaaagggcaggctgcatgagcatgtaccgcttgacaccggcggcacactgaga
attgaactgaatcatcgttcgtttcaccagctgcaagagatctttattgaaaagacgaac
gataatcgcatattagccgttgcgaaaaacttaagcctcgaggaagaaaccaaggaaaat
ggcaggccggttatccttgtcagtaaggatgtactggtcagggttaaagccgacgcaatc
ggactgcttgctgaagatttcttgaatgaccgggttgtggacaatgatgaaatgtacagc
ggctataaagatttatatatcagccagcagctgttcagctctttttacgggaaaaatcaa
atttcagtaaacgatgtgaaacagcatgcgttttatccgaatcagtttgctttaatgaag
gatgagctaggagggtcctcctcggcagtcggaattgcagacaaaaccggaacggtatta
aaaagactcgtatttgatgatgaacatatatggggaatcaggccgaaaaatgtacagcag
acaatggcattagagcttttgctgcgggaagatattccgcttgtcaccctgatcggcaaa
gcgggaaccggcaaaacgctcttagctttggcggcagggctattacagacagaagacttg
ggaatatataaaaagctggtcgtcgcaaggccgattgttcctgttggcaaggacatcggg
tatttgccaggcgaaaaagaggaaaagctaaagccttggatgcagccgatttttgacaac
ttagagtttctgtttaatgcgaaaaaaccaggggagcttgatgctattttggcgggaatt
ggctcaattcaggtagaggcgctgacttatatcagagggagaagcattccagatcaattt
attatcattgatgaagcgcaaaatttgaccaggcatgaggtgaaaacgttgctgacgaga
gtcggtgagggcagtaaaattgtcttaatgggcgaccctgaacaaattgatcacccatat
ttagacagtctgaacaatggtttggcctatgtggttgagcggtttaaaggacaacccatc
tcaggcagcgtgaagctgttaaaaggtgagagatcaggtctcgcccagcttgcagctgat
ttgctgtaa

DBGET integrated database retrieval system