KEGG   Bacillus subtilis subsp. subtilis 168: BSU14820Help
Entry
BSU14820          CDS       T00010                                 

Gene name
ylaL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 935944
NCBI-ProteinID: NP_389365
Pasteur: BG13349
BSORF: BG13349
UniProt: O07636
Position
complement(1550797..1551282)
Genome map
AA seq 161 aa AA seqDB search
MSVIQVKGNVTYPITIDPSVWIFDDRKFSFDRKGDSQDTYLQSAGDESDLDPERVIREGR
IAPPTLKTEKQYEKQKLMNGSFAMRLGTVLKNAEPNSSATQCVFVTSSGKAAVSLETALN
SIVHFSEAGKPIQEGGPVHIYFEDPVHHKQPITDVKEIEII
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttatccaagtaaaaggcaatgttacatatccaattaccattgatccaagcgta
tggatttttgatgatcgcaaattttcgtttgaccgcaaaggggacagtcaagacacatat
ttacaatcagccggggatgaatccgaccttgatccggaacgcgtcatcagagaggggcga
atcgcgccgcctacattaaagacggaaaagcaatatgagaagcaaaaactgatgaacggc
agtttcgcaatgagacttgggactgtcctgaaaaatgctgagccgaacagctctgcgaca
caatgtgtatttgtcacaagttcgggaaaggccgccgtttctctggaaaccgctctgaac
agtattgtccatttcagtgaggcaggcaagccgattcaagaaggcggccccgtgcatatt
tactttgaagacccggttcatcacaaacagccgattaccgatgtaaaagagatcgaaatc
atttaa

DBGET integrated database retrieval system