KEGG   Bacillus subtilis subsp. subtilis 168: BSU14830Help
Entry
BSU14830          CDS       T00010                                 

Gene name
ylaM
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00471  D-Glutamine and D-glutamate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU14830 (ylaM)
   00220 Arginine biosynthesis
    BSU14830 (ylaM)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSU14830 (ylaM)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BSU14830 (ylaM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 939852
NCBI-ProteinID: NP_389366
Pasteur: BG13350
BSORF: BG13350
UniProt: O07637
Position
1551385..1552314
Genome map
AA seq 309 aa AA seqDB search
MVCQHNDELEALVKKAKKVTDKGEVASYIPALAKADKHDLSVAIYYSNNVCLSAGDVEKT
FTLQSISKVLSLALVLMEYGKDKVFSYVGQEPTGDPFNSIIKLETVNPSKPLNPMINAGA
LVVTSLIRGRTVKERLDYLLSFIRRLTNNQEITYCREVAESEYSTSMINRAMCYYMKQYG
IFEDDVEAVMDLYTKQCAIEMNSLDLAKIGSVFALNGRHPETGEQVISKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYDFGIGIFGPALDEKGNSIAGVKLLEIM
SEMYRLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccagcataatgatgagcttgaagccttagtgaaaaaggcgaaaaaagtaacg
gacaagggggaggtagccagctatattcccgccttggcaaaagctgataaacacgacctg
tcagtggcgatttattattccaataatgtttgtctgtcagcaggtgacgtagaaaaaaca
tttacgcttcaaagtatatcgaaagtcctttcccttgctttggtgttaatggaatacggc
aaagataaggtcttcagttatgttggacaggagccgaccggtgatccgtttaattcaatt
atcaagctcgaaacagtgaatccgagcaagccgttaaaccctatgattaatgccggggca
ttggtagtgacaagtctgataaggggaagaacggtaaaagagagacttgattatttgctt
tcttttatcagaaggctgacaaacaaccaagagattacatactgccgggaagtggctgaa
tctgaatacagcacttcaatgattaatcgggcgatgtgttattatatgaagcagtacggc
atttttgaagatgatgtagaggcagtaatggatttatatacgaagcaatgcgcgattgag
atgaacagcttggatttagcgaaaatcggatctgtattcgcattgaacggcagacatcca
gagactggggagcaggtcatctcaaaagatgtcgctagaatttgcaaaacgtttatggtg
acgtgcggaatgtacaatgcaagcggggaattcgcaattaaggtcggaattcctgcgaaa
agcggcgtatccggcgggataatgggcatttcgccttacgatttcgggatcggcatattc
ggccccgcattagacgaaaaagggaacagcattgcaggtgtaaagcttttggaaataatg
tctgagatgtacaggctgagtattttttaa

DBGET integrated database retrieval system