KEGG   Bacillus subtilis subsp. subtilis 168: BSU14840Help
Entry
BSU14840          CDS       T00010                                 

Gene name
ylaN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1507
Motif
Other DBs
NCBI-GeneID: 936566
NCBI-ProteinID: NP_389367
Pasteur: BG13351
BSORF: BG13351
UniProt: O07638
Position
1552412..1552693
Genome map
AA seq 93 aa AA seqDB search
MASEMIVDHRQKAFELLKVDAEKILKLIRVQMDNLTMPQCPLYEEVLDTQMFGLSREIDF
AVRLGLVDEKDGKDLLYTLERELSALHDAFTAK
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
ttggcttcagagatgatagttgaccatcggcaaaaagcttttgaactcttaaaagtggac
gctgagaagattttgaagctgatccgagtacaaatggataacttaacgatgcctcaatgt
cctctatatgaagaggttttagatactcaaatgttcgggctttcgagggaaatcgatttt
gctgtccgcctgggattggttgatgaaaaagacggtaaagaccttttatacacattggag
cgcgaattgtctgctttgcatgacgcgtttacagctaaataa

DBGET integrated database retrieval system