KEGG   Bacillus subtilis subsp. subtilis 168: BSU14850Help
Entry
BSU14850          CDS       T00010                                 

Gene name
ftsW
Definition
(RefSeq) lipid II flippase FtsW
  KO
K03588  cell division protein FtsW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU14850 (ftsW)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU14850 (ftsW)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BSU14850 (ftsW)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU14850 (ftsW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-GeneID: 935918
NCBI-ProteinID: NP_389368
Pasteur: BG13352
BSORF: BG13352
UniProt: O07639
Position
1552899..1554110
Genome map
AA seq 403 aa AA seqDB search
MLKKMLKSYDYSLIFAIVLLCGFGLVMVYSSSMITAVSRYGVSSNFFFMRQLFALIAGGA
LFILMALFPYKALAHQKFQKGILLVSVLALISLFVFGHVAGNAQSWFKIGGMSIQPGEFV
KLVVILYLAAVYAKKQSYIDHLLTGVAPPVVMTLIICGLIAMQPDFGTAMIIGLIATCMI
LCSGFSGKTLVRLVILGGIVFILVSPIIYLNQDKILTEGRLARFESLEDPFKYANSSGLQ
VINSYYAISSGGIFGLGLGESIQKYGYLPESHTDFIMAVIAEELGIFGVLFVIFLLGFVV
IKGFYIARKCEDPFGSLLAIGISSMIAIQSFINLGGVSGLIPITGVTLPFISYGGSSLVL
LLGSMGILANISMFVKYSENKKKKEPLAPKGMKKKQLKKTVYL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaatgctaaaatcttatgattactcactgatattcgcaatcgttttatta
tgcggattcggtttagtgatggtatacagctcaagcatgattacggctgtctcccggtat
ggagtaagcagtaattttttcttcatgcggcagctgtttgctttaattgcgggtggcgct
ctatttattctcatggcgttgtttccttataaagcactggcccatcaaaagtttcagaag
gggatactgcttgtatctgttcttgcgcttatctcactgtttgttttcgggcatgttgcc
ggaaacgcgcagagctggtttaaaatcggcggaatgagtattcagccgggggagtttgtg
aaactggtcgtgattttataccttgcagccgtatatgcaaaaaaacaaagttatatcgac
catctgttaacgggagtagcccctccggtagtcatgacgcttataatttgtgggttaatt
gccatgcagccagatttcggtacagccatgattatagggttaattgcgacgtgcatgatc
ttgtgctccggcttcagcggaaagacgctggtgaggcttgtgatactgggcggaattgtt
ttcattttagtcagccctattatctatttgaatcaggacaaaattttaactgaaggccgt
ttagcgcgttttgagagtcttgaagacccatttaagtatgcaaattcatcaggtttgcaa
gtgatcaattcttattatgcgatcagctcaggcggcattttcggcctggggctcggtgaa
agtatccaaaaatacggatatctgcctgaatcacacactgactttattatggctgtcatt
gctgaagagctcggcatttttggggtattgtttgtgattttcttattgggttttgtcgtc
ataaaaggtttttatattgccagaaaatgcgaggacccgtttggaagtcttctggcgatc
ggcatttcaagcatgattgccatccagtcgtttattaaccttggcggtgtcagcggatta
attccgattacaggggttacgctgccatttatcagttacgggggctcttctttggtgctg
ctgctggggagtatggggatattagcgaatatcagcatgtttgtgaaatattcagagaat
aagaaaaagaaagagcccttggcgccgaagggaatgaaaaagaaacagctcaaaaaaact
gtttatctgtaa

DBGET integrated database retrieval system