KEGG   Bacillus subtilis subsp. subtilis 168: BSU14860Help
Entry
BSU14860          CDS       T00010                                 

Gene name
pycA
Definition
(RefSeq) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00020  Citrate cycle (TCA cycle)
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSU14860 (pycA)
   00620 Pyruvate metabolism
    BSU14860 (pycA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BSU14860 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C ATP-grasp_3 HlyD_3 HlyD_D23 RimK GCV_H ATP-grasp_4 ATPgrasp_Ter RnfC_N
Motif
Other DBs
NCBI-GeneID: 935920
NCBI-ProteinID: NP_389369
Pasteur: BG12660
BSORF: BG12660
UniProt: Q9KWU4
Position
1554185..1557631
Genome map
AA seq 1148 aa AA seqDB search
MSQQSIQKVLVANRGEIAIRIFRACTELNIRTVAVYSKEDSGSYHRYKADEAYLVGEGKK
PIDAYLDIEGIIDIAKRNKVDAIHPGYGFLSENIHFARRCEEEGIVFIGPKSEHLDMFGD
KVKAREQAEKAGIPVIPGSDGPAETLEAVEQFGQANGYPIIIKASLGGGGRGMRIVRSES
EVKEAYERAKSEAKAAFGNDEVYVEKLIENPKHIEVQVIGDKQGNVVHLFERDCSVQRRH
QKVIEVAPSVSLSPELRDQICEAAVALAKNVNYINAGTVEFLVANNEFYFIEVNPRVQVE
HTITEMITGVDIVQTQILVAQGHSLHSKKVNIPEQKDIFTIGYAIQSRVTTEDPQNDFMP
DTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLVKLSTWALTFEQAAAKMVRNLQE
FRIRGIKTNIPFLENVAKHEKFLTGQYDTSFIDTTPELFNFPKQKDRGTKMLTYIGNVTV
NGFPGIGKKEKPAFDKPLGVKVDVDQQPARGTKQILDEKGAEGLANWVKEQKSVLLTDTT
FRDAHQSLLATRIRSHDLKKIANPTAALWPELFSMEMWGGATFDVAYRFLKEDPWKRLED
LRKEVPNTLFQMLLRSSNAVGYTNYPDNVIKEFVKQSAQSGIDVFRIFDSLNWVKGMTLA
IDAVRDTGKVAEAAICYTGDILDKNRTKYDLAYYTSMAKELEAAGAHILGIKDMAGLLKP
QAAYELVSALKETIDIPVHLHTHDTSGNGIYMYAKAVEAGVDIIDVAVSSMAGLTSQPSA
SGFYHAMEGNDRRPEMNVQGVELLSQYWESVRKYYSEFESGMKSPHTEIYEHEMPGGQYS
NLQQQAKGVGLGDRWNEVKEMYRRVNDMFGDIVKVTPSSKVVGDMALYMVQNNLTEKDVY
EKGESLDFPDSVVELFKGNIGQPHGGFPEKLQKLILKGQEPITVRPGELLEPVSFEAIKQ
EFKEQHNLEISDQDAVAYALYPKVFTDYVKTTESYGDISVLDTPTFFYGMTLGEEIEVEI
ERGKTLIVKLISIGEPQPDATRVVYFELNGQPREVVIKDESIKSSVQERLKADRTNPSHI
AASMPGTVIKVLAEAGTKVNKGDHLMINEAMKMETTVQAPFSGTIKQVHVKNGEPIQTGD
LLLEIEKA
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcagcaatcgatacaaaaagtattagtagcaaacaggggagaaattgcaatccga
atattccgggcgtgtaccgagttgaatattcgtacagttgcggtctattcaaaagaagat
tccggttcctaccatcggtacaaagcggatgaagcatacttggtcggtgaagggaaaaaa
ccgattgatgcttacctggatattgaaggtatcattgatattgcgaaaagaaacaaagtc
gatgcaattcatccgggatacggtttcttatctgaaaatattcattttgcgagacgatgt
gaagaagaaggcatcgtattcatagggccaaaatccgagcatctcgatatgtttggtgac
aaggtaaaagcgcgtgagcaggcagaaaaagcgggaatccccgtgattccgggaagcgac
ggtcctgccgaaacgcttgaagccgtcgaacaatttggacaagctaacggttatccgatc
atcattaaagcctcgcttggcggcggcggccgcggtatgcggattgtcagatctgaaagt
gaagttaaagaagcatatgagcgtgctaaatcagaggcgaaagcagcctttggcaatgat
gaagtttatgtagaaaaattaattgagaatccgaaacatattgaggttcaggtcattgga
gacaagcagggcaatgtcgtccatctttttgagagggattgctccgttcaaagacgccat
caaaaagtcattgaagtggcgccgagtgtctcgctgtcacctgaattaagggaccaaatt
tgtgaggctgcagttgcgcttgccaaaaatgtaaactatataaatgcggggacggtcgaa
ttccttgttgcaaacaacgagttctactttattgaagtaaatcctcgcgtacaagttgaa
cacacgataacagaaatgattactggtgtcgatattgttcaaactcagatccttgttgcc
caagggcacagccttcacagcaaaaaagtaaatattcctgagcaaaaggacatttttaca
atcggctatgccattcagtcacgggttacgactgaggatccgcaaaatgatttcatgcct
gatacaggaaaaatcatggcttaccgctcaggcggcggttttggtgtccgtcttgatacc
ggaaacagcttccagggcgccgtgatcacaccatactatgattcacttctcgttaagctt
tcaacttgggctttaacgtttgaacaggcagctgccaaaatggtgcgaaaccttcaggag
tttagaatcagaggcataaaaacgaacattccgttccttgagaacgttgcaaagcatgag
aagttcctgacagggcaatatgatacatctttcattgatacaacgcctgaattatttaat
ttccctaaacaaaaagaccgcggaacgaaaatgctcacttacatcggcaatgtgacagtg
aacggcttccctggaatcgggaaaaaagaaaaaccggcgtttgacaaaccgttaggcgta
aaggtagacgttgatcagcagcctgccagaggaacaaagcaaattctcgatgaaaaaggt
gcagaagggcttgcaaattgggttaaggagcagaaatctgtccttttaactgatacgaca
ttcagggatgcccaccaatcgttattggcaactagaatcagatcgcatgatttgaaaaaa
atcgcaaatccgacggctgcgttatggcctgaactattcagtatggaaatgtggggaggc
gcgaccttcgatgtagcctaccgattcctgaaagaagatccgtggaaacgtttggaagat
cttcgcaaagaagtgccgaataccttattccagatgttgcttcgctcatcaaatgcggtc
ggctatacgaattatccggacaatgtgattaaagaatttgtgaagcaatcagctcaatcc
ggtattgatgtgtttcgtattttcgacagcttaaactgggtaaaagggatgacgttagcc
attgatgctgttagggataccggcaaagtggcagaagctgcgatttgttatacgggagat
atccttgacaagaaccggacgaagtacgaccttgcatattatacatcgatggcgaaggag
cttgaggcggccggagcccatattctcgggattaaagatatggcagggctgttaaaaccg
caggctgcatatgagctcgtttctgcgttgaaagaaacgatcgacattccggttcacctt
catacgcatgatacgagcggaaacggtatttatatgtatgcgaaagctgttgaagccggc
gttgatatcatagacgtggcggtcagctcaatggcgggattaacgtcacagcctagcgcg
agcggattttatcatgcgatggaaggcaacgaccgccgtccggaaatgaatgtccaaggc
gttgaattgctgtcccaatattgggagtcggtgcgtaaatattatagtgaatttgaaagc
ggaatgaagtctccgcatactgaaatttatgaacacgaaatgccagggggccaatacagc
aacctgcagcagcaagccaagggagtaggccttggcgaccgctggaacgaagtcaaggaa
atgtacagacgcgtgaacgatatgttcggtgacatcgtcaaggtaacgccttcctcaaaa
gtagtcggagatatggcactctacatggtgcaaaacaatctgactgaaaaagacgtttac
gaaaaaggtgaatctttagatttccctgattctgtcgtggagctttttaaaggaaatatc
ggccagcctcatggcggattcccagaaaaactgcaaaagctgatcttaaaagggcaggag
ccgattacagtcagaccgggcgaactgcttgagccggtgtcatttgaagcgatcaaacag
gaatttaaagagcagcataacttggaaatttcagatcaggatgctgtggcatatgccctt
tatcctaaagtcttcactgattatgtgaaaacgacagaaagctatggagacatctcggta
ttagatacaccgacattcttctacggtatgacattaggtgaagagatagaagttgaaatt
gagcgcggcaaaacgctgatcgttaagctgatttcaatcggtgagcctcagcctgatgcc
acccgcgtcgtttatttcgaactcaacgggcagccgcgtgaagtagtcattaaagatgaa
agcattaagtcttccgttcaggaaaggctgaaagcagaccggacaaatccaagccacatc
gcagcttccatgcctggaacagttattaaggtattggctgaagcaggcacaaaagtcaat
aaaggtgatcatttgatgattaatgaagcgatgaaaatggaaacaacggttcaggcgcct
ttctcaggaacaatcaagcaggttcatgtgaaaaatggtgagccgatccaaacgggagat
ctgctccttgaaattgaaaaagcataa

DBGET integrated database retrieval system