KEGG   Bacillus subtilis subsp. subtilis 168: BSU14880Help
Entry
BSU14880          CDS       T00010                                 

Gene name
ctaB
Definition
(RefSeq) protoheme IX farnesyltransferase 2
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU14880 (ctaB)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU14880 (ctaB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU14880 (ctaB)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU14880 (ctaB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     BSU14880 (ctaB)
Prenyltransferases [BR:bsu01006]
 Compound prenylation
  Protoheme farnesyltransferase
   BSU14880 (ctaB)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU14880 (ctaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-GeneID: 935922
NCBI-ProteinID: NP_389371
Pasteur: BG10214
BSORF: BG10214
UniProt: P24009
Position
1559309..1560226
Genome map
AA seq 305 aa AA seqDB search
MANSRILNDTAIDGQIEETTAWKDFLSLIKIGIVNSNLITTFTGMWLALHISGLSFLGNI
NTVLLTLIGSSLIIAGSCAINNWYDRDIDHLMERTKVRPTVTGKIQPSQALWSGILLVAL
GLIMLLMTTVMAAVIGFIGVFTYVVLYTMWTKRRYTINTVVGSVSGAVPPLIGWTAVEGN
IGVVAWVLFMILFIWQIPHFLALAIKKTEDYRAANIPMLPVVYGFEVTKRQIIVWVACLM
PLPFFLGSLGLPIVILGLLLNIGWLILGLMGFRSKNIMKWATQMFVYSLNYMTIYFVAMV
VLTLF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctaactccagaatcttaaatgatacagctatagacggacaaattgaagaaacaacg
gcatggaaagattttctgtcccttattaaaatagggatcgtcaattctaacctcatcacg
actttcactggaatgtggcttgcactgcatatatccggtttaagttttttaggcaatata
aacaccgttcttcttacgttaatcgggtcttcactgattattgcgggctcctgcgcgatc
aataactggtatgaccgggacattgaccatcttatggagcgtacgaaagtaagaccgacg
gttacgggtaaaattcagccgagtcaggcgttatggtctggaattttgctggttgcttta
ggattgatcatgctgctgatgacaactgtcatggctgctgttatcggttttatcggagtc
tttacgtatgttgtattgtacacaatgtggacgaaacgccgctatacgattaacacagta
gtaggaagcgtttccggtgcagtgccgccgcttattggatggacggcagtggaagggaat
atcggtgtcgtagcatgggtgttattcatgattttatttatttggcagattcctcacttc
ttagcattggctattaagaaaactgaggattacagagctgcaaatattccgatgcttcct
gtcgtatacggatttgaagtgacaaaaagacaaattattgtgtgggttgcgtgcctgatg
ccgcttccgtttttccttggtagcctgggtcttccgattgtcattctcggcttgctgtta
aatatcggctggctgattcttggcttaatgggattccgctccaagaatatcatgaagtgg
gcaacgcagatgttcgtttactcgcttaactacatgacaatctatttcgttgccatggtt
gtcttgacgcttttctaa

DBGET integrated database retrieval system