KEGG   Bacillus subtilis subsp. subtilis 168: BSU14890
Entry
BSU14890          CDS       T00010                                 

Symbol
ctaC
Name
(RefSeq) cytochrome c oxidase subunit 2
  KO
K02275  cytochrome c oxidase subunit II [EC:7.1.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU14890 (ctaC)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     BSU14890 (ctaC)
SSDB
Motif
Pfam: COX2 Cytochrom_C COX2_TM Cytochrome_CBB3 Sulf_transp DUF6077 COX1 Cadherin_C_2 CopD Paired_CXXCH_1 Sid-5 Cytochrome_C554
Other DBs
NCBI-GeneID: 936789
NCBI-ProteinID: NP_389372
Pasteur: BG10215
BSORF: BG10215
UniProt: P24011 A0A6M3ZFQ3
Position
1560466..1561536
AA seq 356 aa
MVKHWRLILLLALVPLLLSGCGKPFLSTLKPAGEVADKQYDLTVLSTLIMVVVVAVVSVI
FFYVIVRFRRSRVGENTIPKQVEGNKFLEITWTVIPILLLIILVIPVVLYTLELADTSPM
DKKGRKAEDALVVNVRANLYWWEFEYPDYGIITSQELIVPTDQRVYFNLKASDVKHSFWI
PSVGGKLDTNTDNENKFFLTFDSKRSKEAGDMFFGKCAELCGPSHALMDFKVKTMSAKEF
QGWTKEMKNYKSTAESDLAKQGEELFKEKNCLSCHAVEPNDKRAEAARTAPNLATFGERT
KVAGVKEANKENVKAWLKDPDSIKPGNKMTGTYPKLSDSETNALYEYLKGLKAESK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggtaaagcattggcgtcttattttattattagccttagtgccgcttctattaagcgga
tgtggaaaaccttttttatccacgctcaagcctgctggcgaggtggctgataaacagtat
gacctgacagtgctcagcacattgattatggtggttgttgttgcagtagtatctgttatc
ttcttttatgtgattgtgagattcagaagatcacgggtcggtgagaacacgataccgaaa
caggtagaggggaataaatttttagaaatcacatggaccgtgatcccgattttgctgctc
attattcttgtgattcctgttgtattatatacgctggagctagcggacacatcaccaatg
gataaaaaaggccgcaaagctgaggatgctcttgtagtcaatgttagggcaaatttatac
tggtgggagtttgagtaccctgattacggcattatcacaagccaggagctgattgtaccg
acagatcagcgtgtatattttaatttaaaagcctctgatgtaaaacattccttctggatt
ccttcagttggaggaaaacttgatacgaatacggataatgaaaataagttcttcctgaca
tttgattcaaaacgaagcaaagaggcaggagatatgttttttgggaagtgtgcagagctt
tgcggcccttcacatgcgctgatggattttaaggtgaagacgatgtctgcaaaagaattt
cagggctggacaaaagaaatgaagaactataagtctacagcagagagcgatttggctaag
cagggtgaagaactgtttaaagagaaaaactgcctgagctgccatgcggtagagccgaat
gataagcgtgcagaagccgctagaacggcacctaacttggcgaccttcggtgaaaggaca
aaagtggcaggggtgaaagaggccaacaaagaaaatgtgaaggcttggctgaaggaccct
gacagcataaagccggggaacaaaatgacaggcacatatccaaagctctcagacagcgaa
acaaatgcgctttatgaatacttaaaaggcttaaaagcggaaagcaagtag

DBGET integrated database retrieval system