KEGG   Bacillus subtilis subsp. subtilis 168: BSU14900
Entry
BSU14900          CDS       T00010                                 

Symbol
ctaD
Name
(RefSeq) cytochrome c oxidase subunit 1
  KO
K02274  cytochrome c oxidase subunit I [EC:7.1.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU14900 (ctaD)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     BSU14900 (ctaD)
SSDB
Motif
Pfam: COX1 IncE DUF2964
Other DBs
NCBI-GeneID: 936898
NCBI-ProteinID: NP_389373
Pasteur: BG10216
BSORF: BG10216
UniProt: P24010 A0A6M3ZAZ5
Position
1561569..1563437
AA seq 622 aa
MLNALTEKRTRGSMLWDYLTTVDHKKIAILYLVAGGFFFLVGGIEAMFIRIQLAKPENAF
LSAQAYNEVMTMHGTTMIFLAAMPLLFALMNAVVPLQIGARDVSFPFLNALGFWLFFFGG
IFLNLSWFLGGAPDAGWTSYASLSLHSKGHGIDFFVLGLQISGLGTLIAGINFLATIINM
RAPGMTYMRLPLFTWTTFVASALILFAFPPLTVGLALMMLDRLFGTNFFNPELGGNTVIW
EHLFWIFGHPEVYILILPAFGIFSEVIPVFARKRLFGYSSMVFAIVLIGFLGFMVWVHHM
FTTGLGPIANAIFAVATMAIAIPTGIKIFNWLLTIWGGNVKYTTAMLYAVSFIPSFVLGG
VTGVMLAAAAADYQFHDTYFVVAHFHYVIIGGVVFGLLAGVHFWWPKMFGKILHETMGKI
SFVLFFIGFHLTFFIQHFVGLMGMPRRVYTFLPGQGLETGNLISTIGAFFMAAAVILLLV
NVIWTSVKGEYVGADPWHDGRTLEWTVSSPPPEYNFKQLPFVRGLDPLWIEKQAGHKSMT
PAEPVDDIHMPNGSILPLIISFGLFVAAFGLLYRSDYAWGLPVIFIGLGITFITMLLRSV
IDDHGYHIHKEELPNDDKGVKA
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgttgaatgcgcttacagaaaagcggacgcgcggatctatgctttgggattatttgacg
acggtggaccataaaaaaatcgcaattctttatttagtggcagggggattcttctttctt
gtcgggggaattgaagcgatgtttatcagaattcagcttgcaaagccggaaaatgcgttt
ctcagtgctcaagcgtacaatgaagtaatgactatgcacggaacgacgatgatctttctg
gctgcgatgccgctcttatttgccttgatgaatgcggttgtgcctttgcagatcggggct
cgggacgtttcgtttccatttttaaacgcgcttggtttttggctcttctttttcgggggc
attttcttaaatctaagctggtttttgggcggagcgccagatgcgggctggacatcatat
gcctcactttcgcttcattctaaagggcacggcatagactttttcgtcctcggactccaa
atatcggggctcgggacgctgatagccgggattaactttttggccacgattatcaacatg
agggctccgggcatgacgtatatgaggctgcctttgtttacatggacgacatttgtggcc
tcggcattgattttgttcgcgtttccgccgcttacggttggattggctctcatgatgctg
gatcggctgttcggaaccaatttctttaatccggagcttggcggaaatacggtcatttgg
gaacatttattttggatcttcggccacccggaggtttatatcctaattttgcctgcattc
ggtattttttctgaggtcatccctgtgttcgccagaaagcgtttgtttggctattcttca
atggtttttgcaatcgtgctcattggctttctgggctttatggtttgggtgcaccacatg
ttcacgactggtctcggcccgattgcaaatgcgatttttgcggttgcaacaatggctatc
gcgattccgaccgggattaagatttttaactggctgttgacgatttggggaggaaatgtg
aagtatacaaccgctatgctgtatgctgtctcatttattccatcctttgtgctcggcggt
gtgacgggagtcatgctggcagctgctgcggctgattatcagtttcatgatacgtatttt
gtggttgcgcacttccactacgtcattattggcggcgttgtattcggccttttagccggt
gttcatttctggtggccgaaaatgttcggtaaaattctgcatgaaacgatggggaaaatt
tcatttgtattgttttttatcggctttcacctcacgtttttcattcagcattttgtcggc
ttaatggggatgccgcgccgggtttatacgtttttgccaggacagggtctggaaaccggc
aacttgatcagtacaatcggggcgttttttatggcggcagctgttattcttctgctggtc
aatgtcatatggacatcggtaaaaggtgaatatgtaggtgctgatccatggcatgacgga
cgtacgctggaatggaccgtttcttcaccgccgccggagtataactttaaacagcttcct
tttgtcagaggacttgatccgctttggatcgagaagcaggcagggcacaaatcaatgacg
ccggcggaaccggttgatgatattcatatgccaaacggctcaatcctgccgctcatcatt
tccttcggcctttttgtcgcagcgttcgggctgctgtacagaagtgattacgcttggggc
ctgccggtgatctttatcgggctcggcatcacatttattacgatgctgcttcgttcagta
attgatgatcacggctatcatattcataaagaggaactgccgaacgatgataaaggggtg
aaggcataa

DBGET integrated database retrieval system