KEGG   Bacillus subtilis subsp. subtilis 168: BSU14910
Entry
BSU14910          CDS       T00010                                 

Symbol
ctaE
Name
(RefSeq) cytochrome c oxidase subunit 3
  KO
K02276  cytochrome c oxidase subunit III [EC:7.1.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU14910 (ctaE)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     BSU14910 (ctaE)
SSDB
Motif
Pfam: COX3 DUF4436 FxsA
Other DBs
NCBI-GeneID: 935993
NCBI-ProteinID: NP_389374
Pasteur: BG10217
BSORF: BG10217
UniProt: P24012 A0A6M4JFZ3
Position
1563437..1564060
AA seq 207 aa
MQVQEKFTAETFPASPEKVTLEGKNKFLGFWLFLGGETVLFASLFATFLALRNSNAGDPP
TTEMFDVTLVFIATMLLLTSSLTSVYAMYHMKNFSFGKMQLWLGITILLGAGFLGLEIYE
FKHYTHEFGFTITSSALGSAFYTLVGTHGAHVAFGLMWISTLMIRNAKRGLNLYTAPKFY
VASLYWHFIDVVWVFIFTVVYLMGMVG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgcaagttcaagaaaaattcaccgcagaaacctttccagcttctcctgaaaaagtaacc
ctggaagggaaaaataaatttttaggcttttggctttttcttggcggagagactgttctg
tttgcgtctctcttcgccacgtttcttgcgcttcggaattcaaatgccggtgatccgcct
acgacggaaatgttcgatgtgacacttgtattcattgccacaatgcttctattaacgagc
agtttaacgagtgtgtacgcgatgtaccacatgaagaacttttccttcggcaagatgcag
ctttggctgggaattacgattttattgggggcgggctttttaggactggaaatctatgag
ttcaagcattacacccatgaatttggctttaccatcacaagctctgcccttggttctgcg
ttttacacgcttgtcggtacacacggcgcccacgtggcatttgggcttatgtggatcagc
acgcttatgatccgcaatgccaagagagggctgaatctgtatacggcgcctaagttttac
gttgccagcctttattggcactttattgatgtcgtgtgggtcttcatctttaccgttgta
tatttaatggggatggtgggataa

DBGET integrated database retrieval system