KEGG   Bacillus subtilis subsp. subtilis 168: BSU14920Help
Entry
BSU14920          CDS       T00010                                 

Gene name
ctaF
Definition
(RefSeq) cytochrome c oxidase subunit 4B
  KO
K02277  cytochrome c oxidase subunit IV [EC:1.9.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU14920 (ctaF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     BSU14920 (ctaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX4_pro DUF1422 DUF2207 ECF_trnsprt DUF4231
Motif
Other DBs
NCBI-GeneID: 936259
NCBI-ProteinID: NP_389375
Pasteur: BG10218
BSORF: BG10218
UniProt: P24013
Position
1564063..1564395
Genome map
AA seq 110 aa AA seqDB search
MVDKKSRGHINSDLEFKKKKHAREMKYQVLSFGLMIGLTIVAFLTVATDGVGSWFTIPFI
ILLAAIQVIFQLYYFMHMNQKGHEAPALFLYSGVFVAFITVLAFVTIIWW
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggtcgataaaaaaagcagagggcatatcaatagcgaccttgaatttaagaaaaaaaag
catgcccgggagatgaaatatcaagtcctgtcttttggtttaatgatcggtcttacgatt
gttgcatttctgactgtggccacggacggtgtcggcagctggtttacgattcctttcatt
attttgctagctgcaattcaagtcatttttcagctgtattatttcatgcatatgaatcag
aaagggcatgaggcgccggcactgtttttgtattcaggggtgtttgtcgcgtttatcact
gtgcttgcgtttgtgacaattatatggtggtaa

DBGET integrated database retrieval system