KEGG   Bacillus subtilis subsp. subtilis 168: BSU14920
Entry
BSU14920          CDS       T00010                                 

Symbol
ctaF
Name
(RefSeq) cytochrome c oxidase subunit 4B
  KO
K02277  cytochrome c oxidase subunit IV [EC:7.1.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU14920 (ctaF)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     BSU14920 (ctaF)
SSDB
Motif
Pfam: COX4_pro DUF1422 DUF4231 ECF_trnsprt DUF2070
Other DBs
NCBI-GeneID: 936259
NCBI-ProteinID: NP_389375
Pasteur: BG10218
BSORF: BG10218
UniProt: P24013 A0A6M4JG21
Position
1564063..1564395
AA seq 110 aa
MVDKKSRGHINSDLEFKKKKHAREMKYQVLSFGLMIGLTIVAFLTVATDGVGSWFTIPFI
ILLAAIQVIFQLYYFMHMNQKGHEAPALFLYSGVFVAFITVLAFVTIIWW
NT seq 333 nt   +upstreamnt  +downstreamnt
atggtcgataaaaaaagcagagggcatatcaatagcgaccttgaatttaagaaaaaaaag
catgcccgggagatgaaatatcaagtcctgtcttttggtttaatgatcggtcttacgatt
gttgcatttctgactgtggccacggacggtgtcggcagctggtttacgattcctttcatt
attttgctagctgcaattcaagtcatttttcagctgtattatttcatgcatatgaatcag
aaagggcatgaggcgccggcactgtttttgtattcaggggtgtttgtcgcgtttatcact
gtgcttgcgtttgtgacaattatatggtggtaa

DBGET integrated database retrieval system