KEGG   Bacillus subtilis subsp. subtilis 168: BSU14940
Entry
BSU14940          CDS       T00010                                 

Gene name
ylbA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: YugN
Other DBs
NCBI-GeneID: 939858
NCBI-ProteinID: NP_389377
Pasteur: BG13353
BSORF: BG13353
UniProt: O34743 A0A6M3ZAF9
Position
complement(1565347..1565709)
AA seq 120 aa
MLKFTESGLEGVKAELSWLDDLMESKGLIRAGQWDYERVTYDKKFSTIEGTFYLRIQGIA
AEGDVGSGRAVIQLMSPLLGKHYYPHGVEYGETEEFPVQVVTKSKALIQDIANMLKTVQM
NT seq 363 nt   +upstreamnt  +downstreamnt
gtgttgaagtttactgaaagcggacttgaaggggttaaggctgagctcagctggctagac
gacttaatggaaagcaaaggtcttatcagagcgggtcaatgggattacgagagagtcacc
tatgacaagaagttttcgacgattgagggtacgttttacctgcggatacaaggtattgcg
gcagaaggcgatgtcggaagcgggcgcgccgtgattcaattaatgtcccctctcctagga
aagcattactaccctcatggagtagaatatggagaaacggaagagtttcccgtacaggtt
gtgacaaaaagcaaggcactgattcaggacatagccaacatgttaaaaacagttcaaatg
taa

DBGET integrated database retrieval system