KEGG   Bacillus subtilis subsp. subtilis 168: BSU14950
Entry
BSU14950          CDS       T00010                                 

Gene name
ylbB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: CBS fvmX5
Other DBs
NCBI-GeneID: 938107
NCBI-ProteinID: NP_389378
Pasteur: BG13354
BSORF: BG13354
UniProt: O34682 A0A6M4JIC5
Position
1565849..1566295
AA seq 148 aa
MTKIKDLMTADLQYCTVLDNVYEAAVKMKDANVGAIPVVDEDGETLVGIVTDRDLVLRGI
AIKKPNSQKITDAMTEKPVSVEEDASVDEVLHLMASHQLRRIPVTKNKKLTGIVTLGDLS
LSEQTNERAGSALSDISEGDNREEGFFH
NT seq 447 nt   +upstreamnt  +downstreamnt
atgacaaaaataaaagatctgatgacagccgacttgcaatattgcacggtattagataat
gtatatgaagctgcagtaaagatgaaggacgcaaatgtaggagcgataccggtagttgat
gaggacggggaaacattggtcggcatcgtaaccgaccgcgatctcgtattaagaggaatc
gccatcaaaaaaccgaactcgcaaaaaatcactgacgcgatgactgaaaaacctgtcagt
gtggaggaagatgcttcagtcgatgaggttcttcatttgatggcatcgcatcagctcaga
aggataccagttacaaaaaataaaaaactgactggaattgtcacgcttggtgatctttct
ttatctgagcaaacgaatgaacgtgccggcagcgccttatcggatatttccgaaggggat
aatagagaagaaggcttttttcattaa

DBGET integrated database retrieval system