KEGG   Bacillus subtilis subsp. subtilis 168: BSU14960
Entry
BSU14960          CDS       T00010                                 

Symbol
ylbC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CAP_assoc_N CAP DUF4245 Chordopox_A13L DUF2845
Other DBs
NCBI-GeneID: 937363
NCBI-ProteinID: NP_389379
Pasteur: BG13355
BSORF: BG13355
UniProt: O34586 A0A6M3ZAH6
Position
1566379..1567419
AA seq 346 aa
MKNILRAMVILLIICGTYVLFIQYGSVPEKKSNDSEPQVSNEEAQSGKRIHMPTSGLLSF
MGKHADEVTKKLGEPERIDPSAYDYDWWVYNQGKDQYIQIGVLNNKVVTLFASGNDINAK
PFKIGESTGEVFKTTQVAPFVNVEYKGNSYRFEFSEEDINTRPTVKVGKMYVQLYMDKFE
GKLSSIRAFDAQTFVKQRPYEVVYRGELIKPKAVSDEKWKKIQTTSEKQILDLTNVIRVK
HGLAKLEWDQPTAEVAFGHSEDMKENNYFSHVSKKYGSLKDRLEEGHVDFQQAGENIAYN
YVDGPAAVEGWLNSEGHRKALLNSDYTHLGVGVDRKYYTQNFIKRW
NT seq 1041 nt   +upstreamnt  +downstreamnt
ttgaaaaatatattgagagcaatggttatccttttgattatctgcggaacctatgttctg
tttattcaatatggatctgttcctgaaaagaaatcaaatgacagcgagcctcaggtgtcg
aatgaggaagcgcaaagcggcaaacgaatacatatgccgacttcagggttattgtccttc
atgggcaagcacgccgatgaagtaacgaaaaagcttggggaacctgaacgtattgaccct
tcggcttatgattacgattggtgggtatacaatcaaggtaaggatcaatatatccaaatc
ggggtattaaacaataaagtggtcacattattcgcgtcgggtaatgatattaacgccaag
cctttcaaaattggagaatcaactggcgaagtattcaagaccacccaggtggcaccattt
gtgaatgtagagtataaaggaaattcctatcggtttgaattttctgaagaagatatcaat
acaagaccgactgtaaaggtaggaaagatgtatgtccagctgtatatggacaaatttgag
gggaagctatccagcatcagggcgtttgatgcgcagacctttgtaaagcaaagaccttat
gaggtagtgtaccgcggggaattaattaaaccgaaagccgtttcagatgagaaatggaaa
aagatccaaacaacgagcgaaaagcaaatccttgatttgacgaatgtcatacgcgttaaa
catggacttgcgaagcttgagtgggatcagccaacggcggaagtggcatttgggcatagt
gaggatatgaaggaaaataattatttctcccatgtctctaaaaaatacggctcgctgaaa
gaccgcttagaagaagggcatgttgattttcagcaagcgggagaaaatatcgcatacaat
tatgtggacggtccggctgctgtagaaggctggctgaatagcgaaggccatcgaaaagcg
cttctgaattcagattatacgcatcttggtgtcggagtagaccggaaatattacacccaa
aactttattaagcgatggtaa

DBGET integrated database retrieval system