KEGG   Bacillus subtilis subsp. subtilis 168: BSU14970
Entry
BSU14970          CDS       T00010                                 

Symbol
ylbD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YlbD_coat DUF5396 DUF4423 TBCC_N LXG Ubiquitin_4 FliS DUF3877 AI-2E_transport
Other DBs
NCBI-GeneID: 936929
NCBI-ProteinID: NP_389380
Pasteur: BG13356
BSORF: BG13356
UniProt: O34880 A0A6M4JJP9
Position
1567651..1568049
AA seq 132 aa
MANQHANHSINDFKQFVKKHPKLIKEVRKEQRSWQDVYENWVLFGESDPIWDPYREPEEA
SEAVPETPQKNDFVSKMVTAVKKMDVNQMNEQINKMSQSISSLQSLLNTFSGSGQKHSQP
GSGQHPFSFRKD
NT seq 399 nt   +upstreamnt  +downstreamnt
gtggcgaatcaacatgccaatcattcaatcaatgactttaaacaattcgtcaaaaagcat
cccaagctgataaaagaagtgcgcaaagaacaaagaagctggcaggacgtatatgaaaat
tgggtcctcttcggggagagcgacccgatttgggatccatatcgggaaccggaagaagct
tctgaagctgtgcctgaaacaccgcaaaaaaatgattttgtctcgaaaatggtgacagcg
gtgaaaaagatggatgtcaatcaaatgaacgaacaaatcaataaaatgagccagtcgatc
tcatcgttgcaaagccttcttaatacattttccggaagcggacagaagcattctcagcca
ggctctggacagcatcctttttcttttcgaaaggattaa

DBGET integrated database retrieval system