KEGG   Bacillus subtilis subsp. subtilis 168: BSU14990
Entry
BSU14990          CDS       T00010                                 
Symbol
ylbF
Name
(RefSeq) regulatory protein YlbF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Com_YlbF Occludin_ELL RE_endonuc PA2201_N
Other DBs
NCBI-GeneID: 939945
NCBI-ProteinID: NP_389382
Pasteur: BG13358
UniProt: O34412 A0A6M3ZFR1
Structure
Position
1568420..1568869
AA seq 149 aa
MYATMESVRLQSEAQQLAEMILQSETAENYRNCYKRLQEDEEAGRIIRSFIKIKEQYEDV
QRFGKYHPDYREISRKMREIKRELDLNDKVADFKRAENELQSILDEVSVEIGTAVSEHVK
VPTGNPYFDGLSSCGGGCGSGGSCGCKVS
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtatgcgacgatggaatccgtgcggcttcaaagtgaagctcagcagcttgccgagatg
attctgcagtcggagacggctgagaactaccgcaattgttacaagcgtctccaggaagat
gaagaggcaggtcggattattcgttcttttatcaaaataaaagagcagtatgaggatgta
cagcgttttggcaaatatcatcctgactatagagaaatatcccggaaaatgagggagatc
aaacgtgagctggacctgaacgataaggtggctgacttcaagagagctgaaaatgagctc
cagtccattcttgatgaggtcagcgttgagattgggacagctgtttcggagcatgtgaaa
gttccgactgggaacccttattttgacggtttgtcttcatgcggaggcggctgcggttca
ggcggaagctgcggatgtaaagtgtcctga

DBGET integrated database retrieval system