KEGG   Bacillus subtilis subsp. subtilis 168: BSU15000Help
Entry
BSU15000          CDS       T00010                                 

Gene name
ylbG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2129
Motif
Other DBs
NCBI-GeneID: 939846
NCBI-ProteinID: NP_389383
Pasteur: BG13359
BSORF: BG13359
UniProt: O34658
Position
1568924..1569196
Genome map
AA seq 90 aa AA seqDB search
MENRRQGMVVYLHSLKQSKMLRKFGNVHYVSKRLKYVVLYCDMDQIEKTMDKIASYSFVK
KVEPSYKPFLKLEFESKLDKAKEYDYKIGI
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
ttggagaataggcgccagggcatggttgtgtatctgcactccctaaagcagagcaaaatg
ctgaggaagttcgggaatgtgcactatgtatcaaaacgattaaaatatgtcgtactgtac
tgtgatatggaccaaattgaaaaaacaatggacaagattgcgtcttactcatttgtgaaa
aaagtggagccttcttataaaccgtttttaaaattggaattcgagtcaaagcttgataag
gcaaaagaatacgattataaaatcggcatatag

DBGET integrated database retrieval system