KEGG   Bacillus subtilis subsp. subtilis 168: BSU15010
Entry
BSU15010          CDS       T00010                                 

Symbol
ylbH
Name
(RefSeq) rRNA methyltransferase YlbH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cons_hypoth95 MTS Methyltransf_15 MethyltransfD12 DNA_methylase Methyltransf_24 PrmA Methyltransf_31 UPF0020 RsmJ
Other DBs
NCBI-GeneID: 936402
NCBI-ProteinID: NP_389384
Pasteur: BG13360
BSORF: BG13360
UniProt: O34331 A0A6M3ZAV1
Position
1569519..1570073
AA seq 184 aa
MRVISGSKKGRSLKAVAGTSTRPTTDKVKESIFNMIGPYFDGGRGLDLFAGSGGLGIEAL
SRGFEHCIFVDRDFKAIQTVKSNLKTLELTKHAQVYRNDAERALHAAAKRETGFRGIFLD
PPYKEQKLKALLTLIDEYQMLEEDGFIVAEHDREVELPETVGDLVMTRKETYGLTGVAIY
KKRG
NT seq 555 nt   +upstreamnt  +downstreamnt
atgagagtaatttctggatcaaaaaaaggccgttcactaaaggctgtagccggaacatca
acaagaccgacaaccgacaaagtgaaggaatccattttcaatatgatcggcccttatttt
gacgggggcaggggacttgacttattcgcagggagcggaggtcttggaatcgaagcgctt
tcacgcgggtttgagcattgtatattcgttgaccgtgattttaaagcgattcaaacggta
aaatctaatttgaaaacgctggagcttacaaaacatgcacaggtataccgcaatgatgcg
gaacgtgctttgcacgctgctgctaaaagagaaaccggctttcgcggaatttttctcgat
ccgccgtataaggaacaaaagctgaaagcacttttaactttgattgacgaatatcaaatg
ctggaagaagacggctttatcgtcgctgagcatgacagagaggtcgagcttcccgaaacc
gtaggagatcttgtgatgacaagaaaagaaacctatgggttaacaggtgtagcgatttat
aaaaagagggggtag

DBGET integrated database retrieval system