KEGG   Bacillus subtilis subsp. subtilis 168: BSU15020
Entry
BSU15020          CDS       T00010                                 

Gene name
coaD
Definition
(RefSeq) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00770  Pantothenate and CoA biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSU15020 (coaD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     BSU15020 (coaD)
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-GeneID: 936889
NCBI-ProteinID: NP_389385
Pasteur: BG13361
BSORF: BG13361
UniProt: O34797 A0A6M4JG25
Structure
PDB: 
1O6B

Position
1570078..1570563
AA seq 161 aa
MASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKKPLFSVEERCELLREVTK
DIPNITVETSQGLLIDYAKRKNAKAILRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMT
NNQYSFLSSSIVKEVARYNGSVSEFVPPEVELALQQKFRQG
NT seq 486 nt   +upstreamnt  +downstreamnt
gtggcgagtatagctgtctgtcccggcagttttgatcctgtgacctacgggcatctggac
atcatcaaacgcggggcgcatatttttgaacaagtgtatgtatgtgtgctgaataattct
tcaaaaaagcctttgttcagtgtggaagaacggtgtgagcttctgagagaagtcacaaaa
gacattccgaacataacagttgaaacatcgcaaggcctgttaattgattatgcaaaaaga
aaaaatgcgaaagcgattttaagaggcttgagagctgtatctgattttgaatacgagatg
caggggacatcagtaaaccgggtgcttgatgaatctattgagacgttttttatgatgaca
aacaatcaatattcgtttctaagttcaagcatcgtaaaagaagtggcaagatacaacggc
tcggtatcagagtttgtaccgccggaagtagagttggcgcttcagcaaaaattcagacaa
ggatga

DBGET integrated database retrieval system