KEGG   Bacillus subtilis subsp. subtilis 168: BSU15030
Entry
BSU15030          CDS       T00010                                 

Gene name
ylbJ
Definition
(RefSeq) sporulation integral membrane protein YlbJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Gate
Other DBs
NCBI-GeneID: 936629
NCBI-ProteinID: NP_389386
Pasteur: BG13362
BSORF: BG13362
UniProt: O34765
Position
complement(1570574..1571800)
AA seq 408 aa
MNLSKINTLLIASFFLFLTATVISHPQASFEASKTGLSMWWEVVFPSLLPFFILSELLIG
FGIVRFVGVLLEPFMRPIFRVPGVGGFVLAMGMASGNPAGAKLTARLRQENQISRVEAER
LASFTNSSNPLFIFGAVAVGFFQNASLGILLASAHYLGNLAVGLTMRSYGRKEEQHLRRK
KTIPFPSVKDALHALHTARLAEKRPLGKILGDAVTSSVQTLLMVGGFIILFSVFNRLLSV
VQLTDVLSVFTKGALTLFQLPTQLDIPLLSGMFEITLGSKLVSETDVSLLQKAIIVSFIL
GFSGFSVQAQVAGILSETDIRFKPFFIARLLQGVYAAVFVMLLWKPLYTAWHDPYQYVFK
SLNSSDMSTAFINGWNLLVQIGPAVTLCALFTYIIIFSYRLTNGTKKG
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaacttgtcgaagattaatacacttttgattgcctcgttttttctttttttaacagcg
actgtcatctcacatccacaggcctcattcgaagcctctaaaaccgggctgtctatgtgg
tgggaggttgtgtttccgtcattgctgccattttttattctgtccgaactcttaatcggc
tttggcattgtgcggtttgtcggtgttttgcttgagccttttatgcggccgatctttcgc
gtgccgggtgtcggcggcttcgttcttgctatgggaatggcatcaggaaacccagcgggc
gcaaaactcactgcccgtctgcggcaggaaaatcagatttcaagagtagaggcagaacgg
ctcgcgtcgtttaccaattcttcaaacccgctctttattttcggcgctgttgccgtcggt
ttctttcaaaacgcatcactaggcattttattagcttctgcacactatttggggaatctt
gccgtcggtttaacaatgcgctcctatggccgcaaggaagagcagcatctcagaagaaag
aaaacgatacctttcccttcagtcaaagatgctttacacgctcttcataccgccagactt
gcagaaaaacggcccttaggtaaaattttaggcgacgccgtgacgtcttctgttcaaacg
cttcttatggtaggcggctttattattttattttctgtcttcaatcggctgttgtcagtg
gtccagctgactgatgttttgtctgttttcacaaaaggagcactgactttgtttcagctt
ccgactcaattggacattccgcttttatcagggatgtttgaaattacattaggcagcaag
cttgtcagcgagacagatgtttctcttctgcaaaaagccattatcgtcagctttattctt
gggtttagcggcttttccgtacaagctcaggtggcaggtattttatcggaaaccgacatt
agatttaaaccattctttatcgcacgtttgctgcagggcgtttatgccgctgtcttcgtc
atgcttttatggaaacctctttacacagcatggcatgatccgtatcagtatgtatttaaa
tctcttaacagcagtgacatgtcaactgcctttataaacggctggaatctgcttgtgcag
atcggacctgctgtcacactatgcgcgctgtttacgtacattatcattttttcttacaga
ctgacaaacggaacaaaaaaaggatga

DBGET integrated database retrieval system