KEGG   Bacillus subtilis subsp. subtilis 168: BSU15040
Entry
BSU15040          CDS       T00010                                 

Symbol
ylbK
Name
(RefSeq) NTE family protein YlbK
  KO
K07001  NTE family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU15040 (ylbK)
SSDB
Motif
Pfam: Patatin DUF1269
Other DBs
NCBI-GeneID: 936382
NCBI-ProteinID: NP_389387
Pasteur: BG13363
BSORF: BG13363
UniProt: O34731 A0A6M4JIC4
Position
1571981..1572763
AA seq 260 aa
MAKPKIGLALGSGGARGLAHLGVLSSLHKHQIEVDMIAGSSMGALVGSFYAAGHDVATMK
KVAKAFKRRLYADYTVPKLGFLKGDRVRQLVHAYTFGKPIEELQIPLGIVACDLQTGEKI
VFRKGSVSDAVRASISIPGIFIPQRLDGRLLVDGAVVDRIPVSVVKDMGADIIIASDVSR
VRKTETAVHIFDVIMQSMDILQNELVRHQTIAADIMIRPSLETYSSSSFANIEEMISAGE
EATNRMISKIRKEIENWEGS
NT seq 783 nt   +upstreamnt  +downstreamnt
ttggccaaacctaaaatcgggttagcgttaggatcgggaggggccagagggcttgctcat
ctcggtgtgctttccagtttacataagcaccaaattgaagtggatatgattgcaggaagc
agcatgggcgctttggtgggcagtttttacgccgccggacatgacgtggcaacgatgaaa
aaagtagccaaagcctttaaacgaaggctttatgctgattatacggtgccgaaactcggt
tttttaaaaggtgaccgcgtcagacagcttgtgcatgcttatacattcggaaaaccgatt
gaagagctccaaatcccgctgggcattgttgcgtgtgatctacagacgggagaaaagatt
gtgttccgaaaaggatcagtgtcagatgcagtgagggccagcatcagcatcccgggtatc
tttattccgcagcggctggacggacgccttcttgtagacggcgcggtcgtcgatcgaatt
ccggtttctgttgtgaaagacatgggagctgatattatcatcgcttcggatgtttccagg
gttcgaaaaactgaaacagcagtgcatatttttgatgtgattatgcaaagtatggatata
ctgcaaaatgaattagtgcggcatcaaacaattgccgcagatatcatgattcgcccttcc
cttgaaacatacagctcaagctcgtttgccaatattgaagaaatgatatcggcaggcgaa
gaggcgacaaaccgaatgatcagcaagataagaaaagaaatagagaattgggagggctca
taa

DBGET integrated database retrieval system