KEGG   Bacillus subtilis subsp. subtilis 168: BSU15050
Entry
BSU15050          CDS       T00010                                 

Symbol
ylbL
Name
(RefSeq) hypothetical protein
  KO
K07177  Lon-like protease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU15050 (ylbL)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S16: lon protease family
   BSU15050 (ylbL)
SSDB
Motif
Pfam: PDZ_2 Lon_C PDZ_6 PDZ DUF6288 Tricorn_PDZ tRNA_bind_2 ChlI
Other DBs
NCBI-GeneID: 936755
NCBI-ProteinID: NP_389388
Pasteur: BG13364
BSORF: BG13364
UniProt: O34470 A0A6M3ZAD6
Structure
PDB: 
2KJP

Position
1572765..1573790
AA seq 341 aa
MLRKKHFSWMLVILILIAVLSFIKLPYYITKPGEATELASLIKVEGGYPEKGSLSLMTVK
VGPANPFTYVWAKMHPYYEIVPDESIKEEGESDKEYMKRQLQMMKSSQENAVIAAYQKAG
KKVSYSFNGIYASSVVENMPAKGKIEVGDKIISADGKNYQSAEKLIDYISSKKAGDKVTL
KIEREEKEKRVTLTLKQFPDEPDRAGIGVSLYTDRNVKVEPDIDFEIENIGGPSAGLMMS
LEIYNQLTKPDETKGYDIAGTGTIDVDGKVGPIGGIDQKVVAADKAGKDIFFAPNQNGAS
NSDYKNAVKTAKDIDSNMKIVPVDTMQDAIDYLNKLKAKST
NT seq 1026 nt   +upstreamnt  +downstreamnt
ttgctacgtaaaaaacattttagctggatgctcgtcatcctcatactgatcgccgtttta
tcatttataaaacttccatactatattacaaaaccgggagaagcgacagagcttgcttca
ttgataaaagtggagggaggctacccggaaaaaggaagtctgtccttaatgactgttaaa
gtgggaccggctaatccatttacatatgtgtgggcaaagatgcacccttattatgaaatt
gttcctgatgagagcattaaggaggaaggcgaatcagataaggagtatatgaaaagacag
ctccaaatgatgaaaagctcgcaagaaaatgcggttatagccgcctatcaaaaggcagga
aaaaaagtcagctattcctttaacggcatatacgcaagctcagttgtagaaaacatgccg
gcaaaagggaaaatagaagtcggtgataaaatcatcagcgcagacggcaaaaactatcag
tctgctgaaaagctgattgattatatcagcagcaaaaaagcgggagataaagtcacgtta
aagatcgaaagagaagaaaaagaaaagcgtgtcacccttacgttaaaacaatttcctgat
gagccggatcgggcaggaatcggagtttcgctttatacagacagaaacgtgaaggtagag
cctgatattgattttgaaatcgaaaatattggcggcccgtcagcagggttaatgatgtcc
cttgaaatctataatcagctgacaaaaccagacgaaacaaaaggctacgatattgcggga
acaggtacgattgatgttgacggaaaagtaggcccgatcggcggcattgatcaaaaagtc
gtcgccgcagacaaagccggaaaagacattttcttcgcgccaaatcaaaacggcgccagc
aattccgattataagaacgcagtaaaaacagcaaaagatattgattcaaatatgaagatt
gtgcctgttgataccatgcaggatgcgattgattatttgaataagctgaaagcgaaaagc
acctga

DBGET integrated database retrieval system