KEGG   Bacillus subtilis subsp. subtilis 168: BSU15060
Entry
BSU15060          CDS       T00010                                 

Gene name
ylbM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: HIGH_NTase1 CTP_transf_like HHH_3
Other DBs
NCBI-GeneID: 936548
NCBI-ProteinID: NP_389389
Pasteur: BG13365
BSORF: BG13365
UniProt: O34513 A0A6M4JHV3
Structure
PDB: 
5Y0Q 5Y0N 5Y0O 5Y0P

Position
complement(1573807..1575054)
AA seq 415 aa
MKAVGLVVEYNPFHNGHLYHAQTAKLQTGCDTAVAVMSGHFLQRGEPAVVSKWARTKMAL
QSGVDLVIELPYLYAVQKADIFARGSVSILNELECEALFFGSENGDIKPFLETAQLIDEH
KHILNDRIKEELKKGASYPAAAAIAFSSILHTESALDLSKPNNILGYQYVTSILTGGYPM
KPYTTARISSDYHDADLPEGENHIASATSIRKAMIGQNLEACLRFLPAASARELAAYRKS
FGLWHTPESYFSYLKYSLSTVTARELQQVYEVEEGLEHRIIRSIRKSSSYQEFMELLKTK
RYTWTRLQRMNTHILTRTKKQDMQKLLDNDKAPYIRLLGMTKKGQAYLSEKKKALSVPLV
SKLSSFSHPALDLDVKASRIYSLPIEEPLRTEFDLQEYGHAPIRYDEDEQHFLNV
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgaaagctgtcggattggtggttgaatataatccctttcataacggtcacctttatcat
gcccaaacagcaaagctgcaaaccggatgtgacacggctgtcgcggtcatgagcggacat
tttttacagcgcggggaacccgctgttgtatcaaaatgggcccgaacaaaaatggcgctg
caaagcggagttgatcttgtcattgagctgccttatctttatgccgtgcaaaaagcagac
atttttgcacgcggcagtgtttccatcctgaacgaacttgaatgtgaggcgctgtttttc
gggagtgaaaatggggatatcaagccttttttagaaacagcacagcttattgatgagcat
aaacatatattgaatgaccgaattaaagaagaacttaaaaagggggccagttacccagca
gcggcggctatcgccttcagctccattttgcatactgaaagtgcacttgacttgtcaaaa
ccaaataacattttgggataccagtatgtgacctcgattctaaccgggggatatcctatg
aaaccttatactacggcacgaatctcttcggactatcatgatgccgatctccctgaaggc
gaaaaccatatagcaagtgccacaagcattagaaaagcgatgattggccagaatctcgaa
gcctgccttcgttttctccctgctgcatctgcacgtgaattagcagcttaccgcaaatct
ttcggattgtggcatacacctgaaagctacttttcttacttaaaatacagcctttcaact
gtaacggcacgggaattacagcaagtatacgaggtggaggaaggtttagagcacagaatt
attcgttcgatcagaaaatccagctcctatcaggaatttatggaactgctgaaaacaaaa
cgctatacgtggacaaggctccagcggatgaatacacacattttaaccagaacaaaaaaa
caggatatgcaaaagctgcttgacaacgataaggcgccgtatatcaggcttctcggcatg
acgaaaaaaggacaggcttatttatccgaaaagaaaaaagcactgtctgttccgcttgtc
agcaaactgtcctctttctcccatccagctctcgatctggacgtaaaagcaagcaggatt
tacagcctgccgatagaagagccgctgagaactgagtttgacctacaggaatacggacat
gcaccgattcgatatgacgaagatgaacaacactttttaaatgtatag

DBGET integrated database retrieval system