KEGG   Bacillus subtilis subsp. subtilis 168: BSU15069
Entry
BSU15069          CDS       T00010                                 

Symbol
ylzH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303049
NCBI-ProteinID: YP_003097727
UniProt: C0H411 A0A6M4JJQ7
Position
complement(1575051..1575236)
AA seq 61 aa
MIIAFKIVFVNIFSLQHNAAIEVSLTAEYAMHTLKTKIRRKSFHLQMYHTFLNIARKAEK
I
NT seq 186 nt   +upstreamnt  +downstreamnt
atgattatagcttttaagattgtttttgtcaatattttttctttacagcataatgctgcc
attgaagtatcgttgacagcggaatatgctatgcatacacttaaaacaaaaataaggcgt
aagagttttcatttgcaaatgtaccatacgtttttaaacatagcaagaaaggcggaaaaa
atatga

DBGET integrated database retrieval system