KEGG   Bacillus subtilis subsp. subtilis 168: BSU15070
Entry
BSU15070          CDS       T00010                                 

Gene name
ylbN
Definition
(RefSeq) hypothetical protein
  KO
K07040  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU15070 (ylbN)
Motif
Pfam: YceD
Other DBs
NCBI-GeneID: 936788
NCBI-ProteinID: NP_389390
Pasteur: BG13366
BSORF: BG13366
UniProt: O34445 A0A6M4JGF6
Position
1575264..1575782
AA seq 172 aa
MKWTIYQLHQMPKQSFEFDETVELNELTKLNSDIRRISPVRVKGRADIKSKQVSFDFTIS
GEMLLPCSRTLVDVPYPFEISTKELFIFHHTDDIEDDDVHIVEDDTIDITPIVKEEILLE
IPMQIFCESEQEKGAAPQEGKDWQVISEEDKKNQVDPRLAALEKLLKQDDES
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaaatggacgatttatcagctgcatcaaatgccaaaacaaagttttgagtttgatgaa
acagttgagttaaatgagctgacaaagctgaattctgacattcgccgcatttctcccgtt
cgggtgaagggcagagcggatatcaaatccaaacaggtttcgtttgattttacaatttca
ggcgaaatgcttttgccatgctcaagaacactcgttgatgttccgtatccatttgaaatt
tcaacaaaagaactgtttatatttcatcacacggatgatatagaagatgatgacgttcac
attgttgaggacgatactatcgacataactccgatcgtgaaagaagaaattcttttagaa
atccctatgcaaatcttttgtgaatctgaacaagaaaaaggagctgctcctcaagaagga
aaggattggcaagtcatttcggaagaagacaagaagaatcaagttgatccgagacttgca
gcccttgaaaagctcttaaaacaagatgatgaatcttaa

DBGET integrated database retrieval system