KEGG   Bacillus subtilis subsp. subtilis 168: BSU15090
Entry
BSU15090          CDS       T00010                                 

Symbol
ylbO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Myb_DNA-bind_6 Myb_DNA-binding TPR_MLP1_2 Spc29 AAA_23 TSC22 DUF4140 bZIP_1 TolA_bind_tri Prefoldin FlaC_arch GTP-bdg_M PilJ bZIP_2 DUF5660 FUSC YabA Fungal_TACC GIT_CC DUF5094 THOC7 Shugoshin_N MCM_N KfrA_N Nup54_57_C DivIVA CLU_N UPF0242 Herpes_BLRF2 ZapB EMP24_GP25L Phage_GP20 FtsL_2 DivIC CCDC-167 NUDE_C Spc24
Other DBs
NCBI-GeneID: 935998
NCBI-ProteinID: NP_389392
Pasteur: BG13367
BSORF: BG13367
UniProt: O34549 A0A6M3ZB14
Position
1576129..1576710
AA seq 193 aa
MTITRQDAWTQDEDLLLAEVVLRHIREGGTQLSAFEEVGRALTRTAAACGFRWNSYVRKQ
YQSGIELAKKQRKELRKQIGVHSVNMPNSMKQTASASSEGKRDLSIQDVIQFLEQFKETP
SAQEFQLEREKLKEQIQSLQKELEDLRSENQTLRNQLEMTEEDYKALIDIMDRARKMVVS
KEDGRMKKAAQET
NT seq 582 nt   +upstreamnt  +downstreamnt
ttgaccattacaagacaagatgcttggactcaggatgaggatttgctgctggcagaagtg
gtgcttcgtcatattcgagagggaggaacacagctttcagcctttgaggaggttggaagg
gcgctgaccagaaccgcggcagcctgtggtttcaggtggaactcgtatgtgagaaaacaa
taccagtcaggtatagagcttgcaaaaaagcaaaggaaagaactgagaaagcaaatcggc
gttcattcggtcaatatgccgaattccatgaagcagactgcctcggcatcgtcagaagga
aaacgagatttgtccattcaggatgtcattcaatttctcgaacaattcaaagaaacaccg
tctgcacaagaatttcagcttgaaagggaaaaattgaaggagcaaatccaatcgctgcaa
aaagagcttgaggatttgcggagtgaaaatcagacattgcggaatcagctagagatgaca
gaagaggattacaaggcactgatcgatatcatggatcgggccagaaaaatggttgtttcg
aaggaagacggaagaatgaaaaaagcggctcaagaaacgtaa

DBGET integrated database retrieval system