KEGG   Bacillus subtilis subsp. subtilis 168: BSU15100
Entry
BSU15100          CDS       T00010                                 

Symbol
ylbP
Name
(RefSeq) N-acetyltransferase YlbP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_15 Acetyltransf_10 MOZ_SAS FR47
Other DBs
NCBI-GeneID: 939853
NCBI-ProteinID: NP_389393
Pasteur: BG13368
BSORF: BG13368
UniProt: O34468 A0A6M4JG11
Structure
PDB: 
2PR1

Position
complement(1576767..1577249)
AA seq 160 aa
MTKVERLLINYKTLEEFKKFKEYGIQELSMLEELQDNIIENDSTSPFYGIYFGDKLVARM
SLYQVNGKSNPYFDNRQDYLELWKLEVLPGYQNRGYGRALVEFAKSFKMPIRTNPRMKSA
EFWNKMNFKTVKYDMARDKGENPLIWHPDMDREMTPGESA
NT seq 483 nt   +upstreamnt  +downstreamnt
ttgacaaaggtagaacgtctgcttatcaactataaaacgctggaagaattcaagaaattc
aaagaatacggcattcaggagctttcaatgcttgaagaacttcaggataatattattgaa
aatgacagcacctcgcctttttacgggatttattttggcgataaacttgtagcacgaatg
agtctgtatcaagttaacggcaaatcgaatccctattttgacaaccgccaggattatttg
gagctgtggaagcttgaggttcttccgggctaccagaacaggggatacgggagagccttg
gttgaatttgcaaaatcattcaaaatgccgatccggacaaatccgagaatgaaatcagcg
gaattttggaacaaaatgaactttaaaactgttaagtatgatatggcgcgggacaaaggg
gaaaacccgctcatctggcatcctgatatggatcgcgaaatgacaccgggagagtctgca
tag

DBGET integrated database retrieval system