KEGG   Bacillus subtilis subsp. subtilis 168: BSU15120
Entry
BSU15120          CDS       T00010                                 

Symbol
yllA
Name
(RefSeq) hypothetical protein
  KO
K22136  bacillithiol synthase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU15120 (yllA)
SSDB
Motif
Pfam: BshC Vip3A_N
Other DBs
NCBI-GeneID: 939844
NCBI-ProteinID: NP_389395
Pasteur: BG11424
BSORF: BG11424
UniProt: P55342 A0A6M3ZAH8
Structure
PDB: 
4WBD

Position
1578376..1579995
AA seq 539 aa
MQLTELSIKNQNVFVQHYIDGKEEMSSFFDYSIHHKDMWRERLEDLSSRFFAREELAAYL
TSYHNKFGSSAMQSAIEKLKDPSSAAVVGGQQAGLLTGPLYTIHKIISIIVLAKQQEKEL
QVPVIPIFWVAGEDHDLDEINFVHTSEENGPVKKKLPQSYWKKSSAASTSLDQEKCAAWI
DDVFAAFEETDHTNTLLDNVKRCLRESVTFTDFFELLIADLFQEEGLVLLNSGDPGIKKL
ETAMFQKILRENDELARAVSDQQAFMRQAGYKPIIESGKEQANLFYEYEDERFLIEKDNG
RFVIKELDLGWTRDELHTHMEEHPERFSNNVVTRPLMQEFLIPTLAFIAGPGEINYWGEL
KQAFAVMGFKMPPVMPRLNITILERHIEKKLAERNISLQDAIERGTENQRETYFERQIPE
EFTAVMDQAKSQIEAIHKTVRQEALKVDQSLEPLLLKNAAFIQDQLQFLERTVMKRIEEK
EGYVLKDYERIQNSIKPLLAPQERIWNIMYYLNRYGPKFFTTFKNLPFSFQNQHQVVKL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgcagctaactgaactttccatcaaaaatcagaatgtgtttgtacagcactatatagat
ggcaaagaagaaatgtcttctttttttgattacagtattcatcataaggacatgtggcgc
gaaagactggaagacttatcttcccggtttttcgcaagagaggaattggcggcgtactta
acctcttaccataataaattcggttcaagtgcgatgcagtctgctattgagaagctgaag
gacccgtcaagtgccgctgtagtcggcggacagcaggcaggacttttaacaggaccgctt
tacaccatacataaaatcatttcaatcattgttttagcaaagcaacaagaaaaggaactg
caagtgcctgtcataccaatcttctgggtggctggagaagaccacgatttggatgagatt
aattttgttcacacatctgaagagaatgggcctgtgaaaaaaaagctgcctcagtcttat
tggaagaaatcatcagcagcgagtacatcgcttgatcaggaaaagtgtgccgcgtggata
gatgatgtttttgccgcttttgaagaaacagaccatacgaatacacttctcgacaatgtg
aaacgatgtttaagggaatctgttacgtttactgacttctttgaactgctgatcgcggat
ttgttccaagaagagggcttagttttattaaattctggggatccggggattaaaaagctg
gaaacggccatgttccaaaagattcttcgagaaaatgatgaactcgcccgggctgtatca
gatcagcaggccttcatgcgtcaagcaggctacaaaccgattatcgagtccggaaaagag
caggcgaatctgttttatgaatacgaagatgagcgttttttaattgaaaaagataacggc
cgatttgtcatcaaagagcttgatctaggatggacgagggatgaacttcatacacatatg
gaagaacatccagagcgtttcagcaacaatgttgtaacgagaccgttaatgcaggaattt
ctcattccgactttagcatttattgcagggcctggggaaatcaattattggggcgagctc
aaacaggcatttgcggtgatgggcttcaaaatgcctcctgtcatgccaaggctgaacatt
acgatacttgagcggcatattgagaaaaaactggctgaacggaatatctcattacaagac
gcgattgagcgcggaacggagaatcaaagagagacatacttcgagcgccagattccggaa
gagtttacggcggtgatggatcaggcgaaaagccaaattgaagcgattcacaaaacggtc
cggcaggaggcgttaaaggttgatcaaagcttggaacctttacttctgaaaaatgccgct
tttattcaggatcagcttcaattcttagagcgcacggtgatgaagcgaattgaagaaaaa
gaaggctacgtcttgaaggattatgaaagaattcaaaatagcattaagccgcttcttgcg
ccgcaagaacggatttggaatatcatgtattatttgaacaggtacggtccaaaattcttc
acgacattcaagaatctgccattttcttttcaaaatcaacatcaagttgtcaaactttga

DBGET integrated database retrieval system