KEGG   Bacillus subtilis subsp. subtilis 168: BSU15130
Entry
BSU15130          CDS       T00010                                 

Symbol
yllB
Name
(RefSeq) protein MraZ
  KO
K03925  MraZ protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU15130 (yllB)
SSDB
Motif
Pfam: MraZ
Other DBs
NCBI-GeneID: 935932
NCBI-ProteinID: NP_389396
Pasteur: BG11425
BSORF: BG11425
UniProt: P55343 A0A6M3ZIX6
Position
1580121..1580552
AA seq 143 aa
MFMGEYQHTIDAKGRMIVPAKFREGLGEQFVLTRGLDQCLFGYPMHEWKQIEEKLKALPL
TKKDARAFTRFFFSGATECELDKQGRVNIASSLLNYAKLEKECVVIGVSNRIELWSKVIW
EQYTEEQEDSFAEIAENMIGFDI
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtttatgggtgaatatcagcataccatcgatgcgaaaggccgcatgatcgtacccgct
aaattcagagaaggcctaggtgagcaatttgtgctgactagaggacttgaccaatgtctc
ttcggctaccctatgcacgaatggaaacaaattgaagaaaaactaaaagctcttcctctc
acaaagaaagatgcccgcgcgtttacccgtttcttcttttcaggggcgactgaatgcgaa
ctggataagcaaggcagggtaaatatcgcatcatctctattgaattacgccaaactggaa
aaagaatgtgttgttatcggggtttctaatcgaattgaattgtggagtaaagtaatttgg
gaacaatacacagaagagcaagaagattcatttgctgaaattgctgaaaacatgattggg
tttgatatataa

DBGET integrated database retrieval system