KEGG   Bacillus subtilis subsp. subtilis 168: BSU15140
Entry
BSU15140          CDS       T00010                                 

Symbol
mraW
Name
(RefSeq) ribosomal RNA small subunit methyltransferase H
  KO
K03438  16S rRNA (cytosine1402-N4)-methyltransferase [EC:2.1.1.199]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU15140 (mraW)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.199  16S rRNA (cytosine1402-N4)-methyltransferase
     BSU15140 (mraW)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    BSU15140 (mraW)
SSDB
Motif
Pfam: Methyltransf_5 rRNA_methylase Methyltransf_31 Methyltr_RsmB-F Ubie_methyltran Methyltransf_25 FtsJ CRS1_YhbY
Other DBs
NCBI-GeneID: 936555
NCBI-ProteinID: NP_389397
Pasteur: BG10219
BSORF: BG10219
UniProt: Q07876 A0A6M4JID5
Position
1580622..1581557
AA seq 311 aa
MFQHKTVLLRETVDGLNIKPDGTYVDCTLGGAGHSTYLLQQLSEKGRLIAFDQDDTALQH
AKEVLSDYKGQLILIKSNFRYLKEYLNEQGVTEVDGILFDLGVSSPQLDTPERGFSYHHD
APLDMRMDQSATLSAKEVVNEWRYEDLVRIFFKYGEEKFSKQIARKIEEARMKSPIQTTG
QLVDLIKDAIPAPARRSGGHPAKRVFQAIRIAVNDELRVFEEALEQAIEVLKPGGRVSVI
TFHSLEDRICKTTFKEKSSLPELPPGLPVIPEEFEPELKLITRKPITASQEELEENNRAR
SAKLRIAEKRK
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtttcaacacaagacagtacttcttcgtgaaaccgtagacggacttaatattaaacca
gacggtacatatgtagactgcacactcggcggagctgggcatagtacatacttattgcag
cagttatccgagaaggggcgtttaatcgcttttgaccaagatgatacggcattacagcat
gctaaagaagtgttgtccgattataaaggacagctcattctgattaaaagcaatttcagg
tatttaaaagaatatttgaatgaacaaggcgttacagaagtagacggcattttatttgat
ttaggggtgtcctctccgcagctggatacaccggagcgcggattcagttaccatcatgac
gcaccgttggacatgaggatggaccagtcggctacgctttcggcgaaagaagtcgttaat
gagtggcgctatgaggatctcgtccgtattttctttaaatacggagaagagaagttcagt
aaacagatcgccagaaaaattgaggaggcaagaatgaagtctcctattcaaactacgggc
caactggtcgatctaataaaagacgcgattcccgctccagcgagaaggagcgggggacat
cccgctaaacgcgtgtttcaggcaatcagaattgccgtaaacgatgaacttagggtgttt
gaagaagctttggagcaggcaattgaggttctgaagccagggggcagggtatcggtcatt
accttccactcgctagaagacagaatttgcaaaaccacttttaaagaaaagtcgtcgctt
ccggaacttcctccgggacttcctgttataccggaagagtttgaaccggagctgaagctc
atcacacgaaaaccgattacggcatctcaagaagagcttgaagagaacaaccgggctcgt
tctgccaagcttcggattgctgaaaaaagaaaataa

DBGET integrated database retrieval system