KEGG   Bacillus subtilis subsp. subtilis 168: BSU15150
Entry
BSU15150          CDS       T00010                                 

Gene name
ftsL
Definition
(RefSeq) cell division protein FtsL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: DivIC DUF4577 FtsL_2 DUF4446 DUF6377 DUF2730 FtsL SKN1_KRE6_Sbg1
Other DBs
NCBI-GeneID: 939860
NCBI-ProteinID: NP_389398
Pasteur: BG10220
BSORF: BG10220
UniProt: Q07867 A0A6M3ZAE4
Position
1581597..1581950
AA seq 117 aa
MSNLAYQPEKQQRHAISPEKKVIVKKRASITLGEKVLLVLFAAAVLSVSLLIVSKAYAAY
QTNIEVQKLEEQISSENKQIGDLEKSVADLSKPQRIMDIAKKNGLNLKDKKVKNIQE
NT seq 354 nt   +upstreamnt  +downstreamnt
atgagcaatttagcttaccaaccagagaaacagcagcggcatgcgatcagtcctgagaaa
aaagtgattgtcaagaaaagggcttccattactctcggagaaaaagtgcttcttgtcctc
tttgctgcggcggtgctcagcgtatcgcttttgatcgtatcgaaggcgtatgcggcatat
caaaccaatattgaggtgcaaaagcttgaggagcaaatttcatccgaaaataagcaaatt
ggtgacctcgaaaaaagcgttgctgatttaagcaaaccgcagcgcattatggacattgcg
aaaaagaacggcttgaatttaaaagataaaaaagtgaaaaacatacaggaatga

DBGET integrated database retrieval system