KEGG   Bacillus subtilis subsp. subtilis 168: BSU15150Help
Entry
BSU15150          CDS       T00010                                 

Gene name
ftsL
Definition
(RefSeq) cell division protein FtsL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIC DUF4577 DUF2730 DUF4446 FtsL SKN1
Motif
Other DBs
NCBI-GeneID: 939860
NCBI-ProteinID: NP_389398
Pasteur: BG10220
BSORF: BG10220
UniProt: Q07867
Position
1581597..1581950
Genome map
AA seq 117 aa AA seqDB search
MSNLAYQPEKQQRHAISPEKKVIVKKRASITLGEKVLLVLFAAAVLSVSLLIVSKAYAAY
QTNIEVQKLEEQISSENKQIGDLEKSVADLSKPQRIMDIAKKNGLNLKDKKVKNIQE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttagcttaccaaccagagaaacagcagcggcatgcgatcagtcctgagaaa
aaagtgattgtcaagaaaagggcttccattactctcggagaaaaagtgcttcttgtcctc
tttgctgcggcggtgctcagcgtatcgcttttgatcgtatcgaaggcgtatgcggcatat
caaaccaatattgaggtgcaaaagcttgaggagcaaatttcatccgaaaataagcaaatt
ggtgacctcgaaaaaagcgttgctgatttaagcaaaccgcagcgcattatggacattgcg
aaaaagaacggcttgaatttaaaagataaaaaagtgaaaaacatacaggaatga

DBGET integrated database retrieval system