KEGG   Bacillus subtilis subsp. subtilis 168: BSU15170
Entry
BSU15170          CDS       T00010                                 

Symbol
spoVD
Name
(RefSeq) stage V sporulation protein D
  KO
K08384  stage V sporulation protein D (sporulation-specific penicillin-binding protein)
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU15170 (spoVD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU15170 (spoVD)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BSU15170 (spoVD)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer PASTA
Other DBs
NCBI-GeneID: 936661
NCBI-ProteinID: NP_389400
Pasteur: BG10222
BSORF: BG10222
UniProt: Q03524 A0A6M4JJR6
Position
1584214..1586154
AA seq 646 aa
MRVSNVTVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERG
EILDRNGVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVLNMSEEKVYKHVTKKASIEKI
TPEGRKISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYY
DDDLKGEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAK
YHPDGMIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIIT
LAAALEEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGE
RLGKEKLFKYIKDFGFGQKTGIDLQGEGTGILFPLERVGPVEQATTAFGQGVSVTPIQQV
AAVSAAVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAE
GTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGT
IQFGGTVAAPIVGNIMRDSLPELGVKPRKNQIEKKYQWNDTKTIEVPNVVGMSVSDLESL
LVNLNVDASGKGSKIVKQSPAAGTKVKEGSKIRVYLTEEDEKEAAD
NT seq 1941 nt   +upstreamnt  +downstreamnt
ttgcgcgtctcgaatgtaacggttagaaaacgtttattatttgttttgctttttggcgtg
atcgtgtttctgatcattgatacaaggctggggtatgttcagtttgtgatgggcgaaaaa
ctgacttcgctagcgaaagattcctggagccggaacttgccgtttgagccggagagaggc
gagattctggatcggaatggtgtgaagctcgcaacaaataaaagtgcgccgaccgtattc
gtcgtgccgcgccaagttcagaatccgatgaaaacgagcaagcagcttgcggcggtgctc
aatatgtcagaagaaaaagtatataaacatgtgacaaaaaaagcgtcaatcgaaaagatc
actcctgaagggagaaaaatttcaaatgagaaggcgaaagaaatcaaagcgcttgattta
aaaggtgtgtatgttgcggaggacagtatccgtcattacccgttcggcagctttttatct
catgtgcttggatttgcaggaattgacaaccaagggctccttggacttgaagcctattac
gacgatgatttaaaaggggaaaaaggttctgttaagttttatacagatgccaaggggaag
aagatgcctgatgaagcggatgactatacgccgcctaaggatgggcttgatatgaagctg
acagttgattcaaaggttcagacgataatggaaagagagcttgataacgctgaggccaaa
tatcatccggacggcatgattgccgtagccatgaatccgaaaaacggagaaattttgggg
atgtctagcaggcctgacttcgaccctgctgattaccaatctgttgatccgtccgtctac
aatcgaaatctgccagtatggagcacgtatgaaccgggatctacctttaaaattattaca
cttgcagcagcccttgaagagcaaaaagtaaatttgaaacgggatcaattttatgataaa
gggcatgctgaagtggacggagcgagactgcggtgctggaaaagaggcgggcacgggctg
cagacgtatctggaagttgtgcagaactcctgcaacccggggtttgttgaattaggcgag
cgcttaggaaaggaaaagcttttcaaatatatcaaagactttggttttggacaaaaaacg
gggattgatctccaaggcgagggaacaggcatcttattcccgcttgagagagtgggcccg
gtggagcaagcaactacggctttcggacagggagtatccgtcacgccgattcagcaggtt
gcagcagtatccgccgctgtaaacggaggaacgctctatacaccttatattgcaaaggaa
tggatcgatcctgttacgaagaaaacggtcaaaaaacaatcaccaatcgcaaagaaacaa
gtcatttctgaggaaacatccaaacaaatccgctatgctctagaaagcgtcgtcgcagaa
ggaaccggccgcaatgcatttgtagaaggatatcgtgtcggaggaaaaacgggaactgca
caaaaggttaaagatggaaaatatcttgaaaacaaccatattgtatcatttatcggtttc
gcgccagcagatgatccgagtctagtcgtctacgttgcggtggataacccgaaaggcacg
attcagtttggcggaacggtggcagcgcctattgtcggaaatattatgagagacagtctg
ccggaacttggtgtgaagccccggaaaaatcaaatcgagaaaaaataccaatggaacgac
acaaaaacaatagaagttccgaatgttgtagggatgtctgtctcagatcttgagtcacta
ttggtgaatctcaatgtggatgcttccgggaaagggagcaaaatcgttaaacaatcgcca
gctgccggaacgaaagtaaaagaaggctcaaagatacgcgtgtatttgactgaagaagat
gaaaaggaggcagccgattga

DBGET integrated database retrieval system