KEGG   Bacillus subtilis subsp. subtilis 168: BSU15180
Entry
BSU15180          CDS       T00010                                 

Symbol
murE
Name
(RefSeq) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU15180 (murE)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU15180 (murE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU15180 (murE)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BSU15180 (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Amino acid ligase
   BSU15180 (murE)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-GeneID: 937567
NCBI-ProteinID: NP_389401
Pasteur: BG10223
BSORF: BG10223
UniProt: Q03523 A0A6M4JGG3
Position
1586330..1587814
AA seq 494 aa
MKLTKLLTYLTTEPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVEN
GAAAIVAEREVDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMV
DEILKKAGKRTGLIGTMYMKIGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSH
ALSLGRVHGCDYDIAVFTNLTQDHLDYHKTMDEYRHAKSLLFSQLGGAFNHEHPKRAVLN
ADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGTSFDLVTNKGTKHITMSLVGQ
FNVYNVLAAVATCIAAGIPFEIITEAVEELHGVRGRFELVNQQQEFPVIVDYAHTPDSLE
NVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR
DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVA
ARAIVELNKNKTNS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaaacttacaaagctgcttacatacttaacaaccgaaccttctgtaaacgactcacaa
gaccctgaaataacttcaattgagatggactccagggaagtaaagaaagggagtcttttt
gtatgtgtaaaagggtatacggtggatggccacgattttgcgcaaaaagcagtagaaaac
ggtgcagcggctattgtggcagaaagagaggtcgatgtgaatgttcctgttattattgtc
cggcagtcacttcgcgcgctcagcgttttgtctgatgcgttttacggacagccgacgaag
aagcttcagctgattgggataacagggacaaacggcaaaacatcaacgacccacatggtc
gatgagattctgaaaaaagcgggaaaacgcacaggcttgatcggtacaatgtacatgaaa
atcggagacgaaacacttcctgttaaaaacacgactccggaaagcgtcacgctgcagaaa
acgtttaagaaaatgaatgacaagcacgttgacactgcaatcatggaggtttcttcccac
gctttgtctttaggacgcgtccatggctgtgattatgatattgccgtgtttacgaattta
acacaggaccatctggactatcataaaacgatggatgagtaccggcatgcaaaaagcttg
ctcttttcccaacttggcggggctttcaaccatgaacatccaaagcgtgccgtcctgaat
gctgacgatgaggcgagcgcttattttgaaaaggtaacagctgcgcatatctctacatac
ggaattaaaaacgatgctgatgtgatggcgaagaacatcagtatcactgcacagggcaca
agctttgatctcgtgacaaacaaaggcacgaagcacatcacgatgtctctcgtcggacaa
tttaatgtgtataacgtgctggccgctgttgcgacatgtattgcagcaggcataccgttt
gaaatcatcactgaggctgttgaagaattgcatggtgtaagaggccgttttgaattggtc
aatcagcagcaggagtttcctgtcattgtagactacgcgcacacaccggacagccttgaa
aatgtgctggagacatgcagagacatgacggaaggaaagctatttgtcgttgtcggctgc
ggaggagacagagataagacgaagcgcccgaaaatggctaaaattgctgtggagctggct
gacgagccgattttcacgtcagataacccgagaagcgaagatcctcgcgcgattttaaga
gatatggaagccggagtagagaacgcatactatcacagtattgcaaaccgcgagcaggcg
atctttttcgcaattgccaatgccaaaaaaggcgacgttgtcctcattgccggaaaagga
catgaaacctatcagcagatcggaaatgaaactttcgattttgatgatgctgaagtagcg
gcgagagccattgttgaactcaataagaataagacgaattcatag

DBGET integrated database retrieval system