KEGG   Bacillus subtilis subsp. subtilis 168: BSU15190
Entry
BSU15190          CDS       T00010                                 

Symbol
mraY
Name
(RefSeq) phospho-n-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
bsu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU15190 (mraY)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSU15190 (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU15190 (mraY)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     BSU15190 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Glycosyltransferase
   BSU15190 (mraY)
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1 VitK2_biosynth
Other DBs
NCBI-GeneID: 939856
NCBI-ProteinID: NP_389402
Pasteur: BG10224
BSORF: BG10224
UniProt: Q03521 A0A6M4JMT9
Position
1587926..1588900
AA seq 324 aa
MLEQVILFTILMGFLISVLLSPILIPFLRRLKFGQSIREEGPKSHQKKSGTPTMGGVMII
LSIIVTTIVMTQKFSEISPEMVLLLFVTLGYGLLGFLDDYIKVVMKRNLGLTSKQKLIGQ
IIIAVVFYAVYHYYNFATDIRIPGTDLSFDLGWAYFILVLFMLVGGSNAVNLTDGLDGLL
SGTAAIAFGAFAILAWNQSQYDVAIFSVAVVGAVLGFLVFNAHPAKVFMGDTGSLALGGA
IVTIAILTKLEILLVIIGGVFVIETLSVILQVISFKTTGKRIFKMSPLHHHYELVGWSEW
RVVVTFWAAGLLLAVLGIYIEVWL
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcttgagcaagtcattctgtttacaattttaatggggtttttaattagtgttctgctc
tctccgattcttattccgtttttaagaagattaaaattcggccagagtattagagaagaa
ggaccgaaatcacatcagaaaaaatcagggacaccgacaatgggcggggtcatgatcata
ctttctatcatagtgacaacaattgttatgacacagaagttttcagaaataagccccgaa
atggtgctgcttctgtttgttacgctaggctacggtttgcttggctttttagatgattac
atcaaggttgtcatgaagcgcaatcttggattgacatcaaagcaaaagctgatcggacaa
attattattgcggttgtattttacgccgtgtatcattactacaattttgcgacggatatt
cgcattcctggaactgacttatcatttgatcttggctgggcttactttatccttgtgctc
tttatgctagtcggcggatcaaacgcagttaacctgactgacggccttgacgggttatta
tccggtactgcggcgattgcctttggcgcctttgccattctggcatggaatcagtctcaa
tatgacgtagcgattttctcagttgccgttgtcggtgcagttctgggcttccttgtattt
aatgctcatccggccaaagtttttatgggagatacgggatcgcttgcattgggaggagcc
atcgttaccattgccattttaacgaaattagagatcctgctggttatcatcggcggtgta
ttcgttatcgagacattatccgttattttgcaggtcatcagctttaaaacgacaggtaaa
cgaatctttaaaatgagtccgcttcatcaccattatgagcttgtcggctggtctgaatgg
agagtagtcgtgacgttttgggctgcgggacttttgcttgccgttttaggaatttacatc
gaggtgtggttataa

DBGET integrated database retrieval system