KEGG   Bacillus subtilis subsp. subtilis 168: BSU15200
Entry
BSU15200          CDS       T00010                                 

Symbol
murD
Name
(RefSeq) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00470  D-Amino acid metabolism
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    BSU15200 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU15200 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU15200 (murD)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BSU15200 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Amino acid ligase
   BSU15200 (murD)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase Cytochrom_C552
Other DBs
NCBI-GeneID: 935950
NCBI-ProteinID: NP_389403
Pasteur: BG10225
BSORF: BG10225
UniProt: Q03522 A0A6M4JLL7
Position
1588901..1590256
AA seq 451 aa
MENDQFLQKQHFLILGLAKSGYAAASILHEKGIYVAVNDQKPFEENEPAQKLSEKGIEVV
CGEHPVSLFDQHQITILIKNPGIPYENIMVQEAEKRGIPVWTEIELAYYLTSAKFIGITG
SNGKTTTTTLIYEMLKADSQKALIAGNIGTVASEVAYHADGDEWIVTELSSFQLMGTHAF
RPEISLILNVFDAHLDYHHTRENYEKAKQKVYLHQTASDKAIVNQDDETVVRLAEAGKAE
IVPFSVSKTLEQGAYVKDSMIMFNGEAILPLEEVVLPGAHNLENILAAIAVVKTAGASNE
AVKKVLTSFTGVKHRLQYVTTVNGRKFYNDSKATNILATSKALSAFDKPVILLAGGLDRG
NGFDDLKPYMKHVKAVLTFGQTAPKLEKLGNELGIQHVKRVDNVEQAVSAAFALSNEGDV
ILLSPACASWDQFKTFEERGDMFIDAVHMLK
NT seq 1356 nt   +upstreamnt  +downstreamnt
gtggaaaatgatcaatttttacagaaacagcattttttaatccttgggcttgcgaaaagc
ggatatgcggcggcctccattcttcatgaaaaaggcatttatgttgcagtcaatgatcaa
aagccttttgaagaaaatgaaccggcacaaaagctttctgaaaaaggaatcgaagttgtt
tgcggagagcatccagtttctctgttcgatcagcatcaaatcacgattctgatcaaaaac
ccgggaattccttatgaaaatatcatggttcaggaagcagagaaacgaggtattccggtt
tggacggaaattgagctcgcttactacctgaccagcgccaagtttatcgggattaccgga
tcgaacggtaaaacgaccacgacaacgctaatttacgaaatgctcaaggctgactcgcaa
aaagcactgattgccggaaacatcggcacagtcgcaagtgaggttgcctatcatgctgat
ggagatgaatggatcgttaccgaactgtcttcgtttcagctgatgggaacacacgctttc
agaccggaaatcagcctgattttaaatgtatttgacgcccatctggattatcaccatacg
cgcgaaaactatgaaaaagcgaaacagaaagtgtaccttcatcagactgcttcagataaa
gctattgtcaaccaggatgatgaaaccgtcgtgcgtcttgctgaagccggaaaagccgaa
atcgtcccattttcagtcagcaaaacgcttgaacagggcgcatatgtaaaagacagtatg
attatgtttaacggcgaagccattcttcctctggaagaggttgtactgcccggtgctcat
aacctggagaacattttagcagctattgcagttgtgaaaacggcaggagcatccaatgag
gcggttaaaaaggtgctgacaagctttactggtgtgaagcaccgcctccaatatgtcaca
actgtgaatggccgcaaattttataacgacagtaaagcaacaaacattctggcgacaagc
aaggcgctttcagcttttgataagccggtcattctgcttgcgggcggactggatcgcgga
aatggttttgatgacttgaaaccttatatgaagcatgtcaaagcagtgcttacatttggc
cagacggcgccaaaactcgagaaactcggcaatgaactgggaatacaacatgtcaaacgt
gtcgataatgttgaacaagcagtatctgcggcgtttgcgctctcaaatgaaggagatgtc
atcctgctgtcacccgcgtgtgcgagctgggatcaattcaaaacatttgaagaacgcggt
gacatgtttatagatgccgtgcatatgcttaagtaa

DBGET integrated database retrieval system