KEGG   Bacillus subtilis subsp. subtilis 168: BSU15210
Entry
BSU15210          CDS       T00010                                 

Symbol
spoVE
Name
(RefSeq) stage V sporulation protein E
  KO
K03588  cell division protein FtsW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15210 (spoVE)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU15210 (spoVE)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU15210 (spoVE)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU15210 (spoVE)
SSDB
Motif
Pfam: FTSW_RODA_SPOVE
Other DBs
NCBI-GeneID: 936953
NCBI-ProteinID: NP_389404
Pasteur: BG10226
BSORF: BG10226
UniProt: P07373 A0A6M4JG20
Position
1590317..1591417
AA seq 366 aa
MTTKKTSPDLLLVIITLLLLTIGLIMVYSASAVWADYKFDDSFFFAKRQLLFAGIGVIAM
FFIMNVDYWTWRTWSKLLMVICFFLLVLVLIPGVGMVRNGSRSWIGVGAFSIQPSEFMKL
AMIAFLAKFLSEKQKNITSFRRGFVPALGIVFSAFLIIMCQPDLGTGTVMVGTCIVMIFV
AGARIAHFVFLGLIGLSGFVGLVLSAPYRIKRITSYLNPWEDPLGSGFQIIQSLYAVGPG
GLFGMGLGQSRQKFFYLPEPQTDFIFAILSEELGFIGGTLILLLFSVLLWRGIRIALGAP
DLYGSFVAVGIISMIAIQVMINIGVVTGLIPVTGITLPFLSYGGSSLTLMLMAVGVLLNV
SRYSRY
NT seq 1101 nt   +upstreamnt  +downstreamnt
ttgactactaaaaaaacatcgcctgatttgttattggtcatcattacgttattattatta
acaatcggattaattatggtgtacagtgcgagtgcggtatgggcggattataaatttgac
gactcattctttttcgcgaaacggcagcttttgtttgcgggaatcggcgtcattgctatg
ttttttatcatgaatgttgattattggacttggaggacatggtccaaattgctgatggtt
atctgctttttccttctggtgcttgttttgataccgggcgtcggaatggtgcggaacggt
tcaagaagctggatcggagtcggagcattcagcatacagccttcagagtttatgaagctt
gcgatgattgcattccttgctaaatttctctctgaaaaacaaaaaaacatcacatcgttc
agacgggggttcgtccctgcacttggcatcgtgttttcagcatttttgattatcatgtgc
cagcctgacctcggaacggggacagttatggtcggaacttgtattgtcatgatttttgta
gccggcgcacggatcgcccatttcgtctttctcgggctgatcggcctcagcggatttgtc
gggctcgtactatcggctccatatcggataaagcggattacctcatacttaaatccatgg
gaagacccgctcggaagcggatttcagatcattcaatcgctttatgcagtggggcccggc
gggttgttcggaatggggctcggacaaagcagacagaagttcttttatctgcctgagccg
caaacagactttattttcgccatcttgtcagaggagctgggctttatcgggggaacactt
attttgctcctcttcagcgtcctgctgtggagaggaatcagaattgcgcttggtgcgcct
gatctgtacggaagctttgtcgcagtcggcattatttcaatgattgccattcaagtcatg
ataaatatcggcgtagtcacgggcctgattcctgtaacaggcatcacgctcccgtttctg
agctacggaggctcttcattgactctaatgctgatggcagttggtgtgctgctgaatgta
agccgctactcgaggtattaa

DBGET integrated database retrieval system