KEGG   Bacillus subtilis subsp. subtilis 168: BSU15220
Entry
BSU15220          CDS       T00010                                 

Symbol
murG
Name
(RefSeq) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
bsu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU15220 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSU15220 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU15220 (murG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     BSU15220 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Glycosyltransferase
   BSU15220 (murG)
SSDB
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_trans_1_4 UDPGT Epimerase_2 Glyco_trans_1_3 Glyco_transf_4
Other DBs
NCBI-GeneID: 935929
NCBI-ProteinID: NP_389405
Pasteur: BG10227
BSORF: BG10227
UniProt: P37585 A0A6M4JG48
Position
1591540..1592631
AA seq 363 aa
MRIAISGGGTGGHIYPALAFIKEVQRRHPNVEFLYIGTENGLEKKIVERENIPFRSIEIT
GFKRKLSFENVKTVMRFLKGVKKSKSYLAEFKPDAVIGTGGYVCGPVVYAAAKMGIPTIV
HEQNSLPGITNKFLSKYVNKVAICFEEAKSHFPSEKVVFTGNPRASEVVSIKTGRSLAEF
GLSEDKKTVLIFGGSRGAAPINRAVIDMQDVLKTRDYQVLYITGEVHYEKVMNELKSKGA
ADNMVTKPFLHQMPEYLKAIDVIVARAGATTIAEITALGIPSVLIPSPYVTANHQEVNAR
SLGQHDAAIVLKETELSGEKLIEALDRIVLNEQTLKEMSERTKSLGVPDAAARLYSVLEE
LKK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcgaattgcaataagcggaggcggtacagggggacatatttatcctgctcttgctttt
attaaagaagtgcaaagacgtcatcctaatgtggaatttttatatatcggaacagaaaac
gggctggagaaaaaaattgttgagcgggagaatataccgtttcgttcaattgaaattaca
ggatttaaaagaaaattgtcatttgaaaatgtcaagactgtgatgcgttttctgaagggc
gtcaaaaagagtaaatcgtatttagcggaatttaagcccgatgccgtaattggaacgggc
ggttatgtatgtgggccggttgtctatgccgctgcgaaaatgggaattccgactattgtc
cacgaacaaaacagcctgccgggcatcacgaataagtttctttcaaaatatgttaataaa
gtagcgatttgttttgaagaagcgaaatcacattttcctagcgagaaagttgtatttacg
ggaaacccgagagcctctgaagtcgtctcaataaagacgggacgatcattggctgaattt
gggctttctgaagacaaaaaaacggtcttaattttcggcggaagccgaggcgctgcaccg
attaaccgcgctgtcattgacatgcaggatgtgctgaaaacaagagactatcaagtgctg
tatatcaccggtgaagttcactatgaaaaagtaatgaatgagctgaaaagcaagggtgcc
gctgataatatggtcacaaagccgtttcttcatcaaatgcctgagtatttaaaggccatt
gatgtcattgtggccagagccggtgcgacaacgattgccgaaattactgctctcggaatc
ccaagtgttctgatcccaagtccatatgtgacagcgaatcaccaggaggtcaatgcgagg
tctcttggccagcatgatgcggcgattgtactgaaagaaacagagctcagcggggagaag
ctgattgaagcgctagaccggattgtactgaatgagcaaacgttaaaggaaatgagcgaa
cgaacaaagtcactcggtgttcctgacgcggctgcccgtttatacagcgtactcgaggaa
ttaaaaaaatag

DBGET integrated database retrieval system