KEGG   Bacillus subtilis subsp. subtilis 168: BSU15230
Entry
BSU15230          CDS       T00010                                 

Gene name
murB
Definition
(RefSeq) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSU15230 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU15230 (murB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU15230 (murB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     BSU15230 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BSU15230 (murB)
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-GeneID: 939804
NCBI-ProteinID: NP_389406
Pasteur: BG10228
BSORF: BG10228
UniProt: P18579 A0A6M3ZAI8
Position
1592663..1593574
AA seq 303 aa
MEKVIQELKEREVGKVLANEPLANHTTMKIGGPADVLVIPSSVDAVKDIMDVIKKYDVKW
TVIGRGSNLLVLDEGIRGVVIKLGAGLDHLELEGEQVTVGGGYSVVRLATSLSKKGLSGL
EFAAGIPGSVGGAVYMNAGAHGSDMSEILVKAHILFEDGTIEWLTNEQMDFSYRTSVLQK
KRPGVCLEAVLQLEQKDKESIVQQMQSNKDYRKNTQPYSSPCAGSIFRNPLPNHAGNLVE
KAGLKGYQIGGAKISEMHGNFIVNAGGASAKDVLDLIDHVKKTIREKYEIDMHTEVEIIG
GNR
NT seq 912 nt   +upstreamnt  +downstreamnt
atggagaaagtgatacaggaattaaaagaacgagaagtcggcaaggttcttgcaaatgaa
ccgctcgcgaatcatacaacgatgaaaatcggcggacctgcggatgtattggtcattcca
agcagtgtggatgctgttaaagacatcatggacgtgattaaaaaatatgatgtgaagtgg
acagtcatcggccgcggatcaaatcttcttgttttagatgaaggaattagaggcgtagtg
atcaagctgggggcgggtcttgaccatttggagcttgaaggggaacaagtaacagtcgga
ggcggttattcggtggtccgccttgctacatcattgagcaaaaaaggcctgtccggtttg
gaatttgctgccggcattccaggatcagtcggcggagcggtttatatgaatgccggcgct
cacggttctgatatgagcgagatcctcgtcaaagcgcatattttatttgaagacggaacg
attgagtggctgacaaatgagcagatggatttcagctacaggacatctgtactgcaaaag
aaacgcccgggcgtttgccttgaagctgttttgcagcttgagcagaaggataaggaatca
atcgttcagcaaatgcaaagcaataaagactatagaaaaaatacacagccgtattcaagc
ccttgtgcgggaagcatattcagaaatccgcttccgaatcatgccgggaaccttgtagaa
aaagcaggcttgaaaggatatcaaatcggcggtgcaaagatatcggagatgcacggaaac
ttcatcgtcaatgcggggggagcatcagcaaaagatgtgcttgatctcattgaccatgtg
aaaaagacaatccgtgaaaaatacgagattgatatgcacacagaggttgaaatcatcggc
ggaaatcgctga

DBGET integrated database retrieval system