KEGG   Bacillus subtilis subsp. subtilis 168: BSU15240
Entry
BSU15240          CDS       T00010                                 

Gene name
divIB
Definition
(RefSeq) cell division protein DivIB
  KO
K03589  cell division protein FtsQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15240 (divIB)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU15240 (divIB)
Motif
Pfam: POTRA_1 FtsQ DUF2116 DUF6377
Other DBs
NCBI-GeneID: 939701
NCBI-ProteinID: NP_389407
Pasteur: BG10229
BSORF: BG10229
UniProt: P16655 A0A6M4JIE2
Position
1593704..1594495
AA seq 263 aa
MNPGQDREKIVNIEERIPKIKEQRKQKANRRLISFIMLFFIMVLIIVYLQTPISKVSTIS
VTGNENVSKKEIIDLSDINSGDTEFWSLDKQKTEKKIQQNKLVKKAEISKSLPNKINIAI
EEYKAIAYLEKDDVYYEVLENGSVLPNEVTPDDAGPILVNWTNAKKRSQMAKQLDALSNS
LKQSISEIYYTPVKMDENRIKLYMNDGYVVTASIKTFADRMKTYPSIISQLSSNKKGIIH
LEVATYFEEFGKNDKAAKKEDEN
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaacccgggtcaagaccgagaaaaaatcgttaacattgaagagcggatccctaaaatt
aaagagcagaggaaacaaaaggcaaaccgccgtctcatttcatttattatgctctttttt
attatggtgctgatcattgtgtacctgcaaacaccaatcagtaaagtatcaacaatctct
gttacagggaatgaaaatgtatcaaaaaaggaaattatcgacctttccgatattaacagc
ggagatactgagttttggagtttggacaagcaaaaaacagaaaagaagattcagcaaaat
aaattagtgaaaaaagcggagatcagcaaatcgcttcctaataaaatcaacattgcaatc
gaagaatataaagcgattgcttatttagaaaaagacgatgtgtactatgaagtgcttgaa
aacggctcagttctgccaaacgaagtaacgccggatgatgccggaccgattttagtgaat
tggacaaacgcgaagaagcggtctcaaatggccaagcagctcgatgcgttgtcaaattcg
ttaaaacagtcgatttcagaaatttattatacgcctgtaaaaatggatgaaaaccgtatt
aagttgtacatgaacgacggttatgttgttacggcatctattaaaacgtttgcagaccga
atgaagacgtatccttctatcatctcacagctaagcagcaataaaaaaggaatcattcat
ttagaagttgccacctattttgaagagtttgggaaaaacgataaagctgctaaaaaggaa
gatgaaaattga

DBGET integrated database retrieval system