KEGG   Bacillus subtilis subsp. subtilis 168: BSU15250
Entry
BSU15250          CDS       T00010                                 

Gene name
ylxW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Motif
Pfam: DUF881 TASL ABC2_membrane_3 Peptidase_S49_N DUF4094 DUF4446 DUF4407 EMC3_TMCO1
Other DBs
NCBI-GeneID: 936403
NCBI-ProteinID: NP_389408
Pasteur: BG11490
BSORF: BG11490
UniProt: C0SPA3 A0A6M3ZAF2
Position
1594492..1595187
AA seq 231 aa
MRGKSAVLLSLIMLIAGFLISFSFQMTKENNKSAAETEEWKKEYALRDELLKQEKENKKF
EKELYQKQNKVRQAENKLKKEKSEYYNVLEDTEKYRMYIGEVGVQGEGVEVTLEDASYIP
EGENVNSYIVHESHIFQVVNELYISGAAAVAVNGQRLTHDSYIKCNGPVVTVDGVQHPAP
FTVSAIGDPDVLLPSLNIAGGLIDQLSMDHISVSAEKEKNVQMKPILKTKE
NT seq 696 nt   +upstreamnt  +downstreamnt
ttgaggggcaaatcagcagtccttctttccttgattatgcttatcgcaggttttttgatt
tcattttcttttcaaatgacaaaagaaaacaacaaaagcgcggctgagacggaagagtgg
aaaaaagaatatgcgctgagagatgaactgctgaaacaagagaaagaaaataagaagttt
gaaaaagaattatatcaaaagcaaaacaaagtccgccaggcggaaaataagctgaagaaa
gagaagtcggaatactataatgtcctcgaagatacagaaaaatacaggatgtatattggg
gaagtcggtgtgcagggagaaggcgttgaggtgacattggaagatgcgtcatacataccg
gaaggggagaatgtgaatagttacatcgttcacgaaagccatatcttccaagtagtaaac
gaactgtatatctcaggagcggcagctgtcgccgttaatggacagcgtttgacgcatgat
tcgtatatcaaatgcaatggtcctgtggtaacggtagacggggtgcagcatcccgctccg
tttacggtatccgctattggagatccagatgtcctgctgccctcgttaaatatcgctgga
ggcctaattgatcagctgtcaatggatcatatttctgtgtcggcagaaaaagagaaaaac
gtacaaatgaaaccgattctgaaaacgaaggaatga

DBGET integrated database retrieval system