KEGG   Bacillus subtilis subsp. subtilis 168: BSU15260
Entry
BSU15260          CDS       T00010                                 

Symbol
ylxX
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF881 DivIC DUF6080
Other DBs
NCBI-GeneID: 936107
NCBI-ProteinID: NP_389409
Pasteur: BG11489
BSORF: BG11489
UniProt: Q45544 A0A6M3ZAK1
Position
1595210..1595917
AA seq 235 aa
MKIKRSFISISVLMVIFGLMISVQFNSLKHPKVRDTRDMWDIREELTSEQKKQEKLLAEI
NKYDKLLNSYSQTKEMTKETALNNTLQSLKKTAGMTDITGSGIVITISPLFSESLTGEPI
ENPPPDLLKKLINELNSYGAEHISINERRVVNHTVIRDINGTTKIDGYALDDYPLTVKVL
AKDPDMLHSRVKGSGLEDLFASENLALKAGKSESKLTLKAYDRPLDVQQLKLLKD
NT seq 708 nt   +upstreamnt  +downstreamnt
ttgaaaataaagcgttccttcataagcatcagtgttcttatggtcatcttcggcctgatg
atatctgttcagtttaattcgttaaagcaccccaaagtccgggatacaagagatatgtgg
gatattagggaagagctgacatcagagcagaagaagcaggaaaagctgctggctgaaata
aacaaatatgacaaattgctgaatagctattcgcaaacgaaagaaatgacaaaagaaacc
gcgctaaataataccttgcaatccttaaaaaaaacagccggcatgaccgatataacaggt
agcggaattgtcattacgatttccccgcttttttctgaaagcttaacaggagagccgatc
gaaaatccgcctccggatttgctgaaaaagctgataaatgaactcaactcctacggtgca
gagcatatctcgattaatgagcgaagagttgtgaatcatacagtcatcagagatataaac
ggcactacaaaaatagacggatacgcccttgacgattatcctttaacagtaaaagtgctt
gccaaagatccggacatgttacacagcagagtgaaggggtcaggccttgaggatcttttt
gcatctgaaaatttagcattaaaagccggtaaatctgaaagcaaactaacattaaaagca
tatgacagaccactggacgtacaacagctgaaactgcttaaagactga

DBGET integrated database retrieval system