KEGG   Bacillus subtilis subsp. subtilis 168: BSU15270
Entry
BSU15270          CDS       T00010                                 

Symbol
sbp
Name
(RefSeq) small basic protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1290
Other DBs
NCBI-GeneID: 936141
NCBI-ProteinID: NP_389410
Pasteur: BG10230
BSORF: BG10230
UniProt: P28265 A0A6M3ZE26
Position
1595935..1596300
AA seq 121 aa
MWLPVLGLVLGIAIGLMTNLTIPSEYSNYLSLAVLAALDTLIGGIRAHLQGTYDEMVFVS
GFFFNIILAISLAFLGVHLGVDLYLAGIFAFGVRLFQNIAVIRRNLLTKWTLSKKNKKNV
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgtggctgcccgtgttgggactggtgctcggaatagcgattggactaatgacaaactta
acgataccgagtgaatactcaaactatttatcgcttgcggtgcttgccgcacttgataca
ttaatcggcggaatcagggcgcatttacaaggtacatatgatgaaatggtatttgtttcc
ggtttcttttttaatattatattggcaataagtttagcttttctgggagtccatcttggt
gtagacttgtatttagcaggtatattcgcatttggagtcagattatttcagaatatagcc
gttatcagaagaaatctactaacaaagtggactctttctaaaaaaaataaaaaaaatgtg
atataa

DBGET integrated database retrieval system