KEGG   Bacillus subtilis subsp. subtilis 168: BSU15280
Entry
BSU15280          CDS       T00010                                 

Symbol
ftsA
Name
(RefSeq) cell division protein FtsA
  KO
K03590  cell division protein FtsA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15280 (ftsA)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU15280 (ftsA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU15280 (ftsA)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   BSU15280 (ftsA)
SSDB
Motif
Pfam: FtsA SHS2_FTSA MreB_Mbl PilM_2 EutA Ppx-GppA DUF3484 HIN
Other DBs
NCBI-GeneID: 936145
NCBI-ProteinID: NP_389411
Pasteur: BG10231
BSORF: BG10231
UniProt: P28264 A0A6M3ZAV0
Position
1596474..1597796
AA seq 440 aa
MNNNELYVSLDIGTSNTKVIVGEMTDDSLNIIGVGNVPSEGLKKGSIVDIDETVHSIRKA
FDQAERMVGFPLRKAIVGVNGNYINIQDTNGVVAVSSENKEIQVEDVRRVMEAAQVVSVP
HEQLIVDVIPKQFIVDGRDEITDPKKMLGVRLEVEGTLITGSKTILHNLLRCVERAGIEI
TDICLQPLAAGSAALSKDEKNLGVALIDIGGGSTTIAVFQNGHLTSTRVIPLGGENITKD
ISIGLRTSTEEAERVKKQLGHAYYDEASEDEIFEVTVIGTNQKQTFTQQEAANIIEARVE
EILEIVSEELRSMGITDLPGGFVLTGGQAAMPGVMSLAQDVLQNNVRVASPNYIGVRDPQ
YMTGVGLIQFACRNARIQGRKIGFKMPEEAIQEIAVSSSEEQEQHHHQNEVQQRPKGKQK
TQAEHNKQSKMKKLLSMFWE
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaacaacaatgaactttacgtcagtcttgacatcggtacgtccaatacaaaagtgatc
gtcggagaaatgacagatgattcccttaatattatcggtgtgggaaatgtaccgtctgaa
gggttgaaaaaaggctcaatcgttgatatagatgagaccgttcattctataagaaaagcg
tttgaccaagctgaaagaatggtaggttttccgcttagaaaagctattgtcggcgttaat
ggaaattatatcaatattcaagatacaaacggtgttgtagcagtttccagtgaaaataaa
gaaattcaggttgaagatgtacgccgtgtcatggaggcggcacaggttgtttccgtaccg
catgaacagctgattgttgacgtcattcctaaacagtttatcgtagatggaagagatgaa
atcaccgacccgaaaaaaatgctgggtgtgcgtttagaagtagagggcaccttgatcacc
ggttcaaaaacaatcttacataacttactccgctgcgttgaaagagctggtattgaaata
actgatatttgccttcagccgctggcagccggttctgctgcattatcaaaggacgagaaa
aaccttggtgtggctctcattgatatagggggagggtcaacaaccattgccgtattccag
aacggacatctcacttctacccgtgtcattcctctcggaggcgaaaatatcaccaaagat
atctccatcggattgagaacgtcaacagaagaagcagaacgcgtgaaaaagcaacttgga
catgcctactatgacgaagcctcggaagatgaaatatttgaggtaaccgttataggcacc
aatcaaaaacaaacatttacacagcaagaagcagcgaatatcattgaagcgagagtagag
gaaattcttgaaattgtttcagaagagcttcgcagtatgggaattaccgatctgccggga
ggcttcgtgctgacaggaggacaagcagctatgccgggtgtcatgtctttggcacaggat
gtgctgcaaaacaatgtcagagtggcaagcccgaattatatcggtgtaagagatcctcaa
tatatgacgggagtgggcctgatccaattcgcctgccggaatgcaagaatccaaggcaga
aaaataggctttaagatgcctgaagaagcgatacaggaaatcgcagtctcatcatctgag
gaacaagagcagcatcatcaccaaaatgaggtgcagcagcggccaaaaggaaaacaaaaa
acacaagccgaacataataaacagagcaaaatgaaaaaactattaagcatgttttgggaa
tag

DBGET integrated database retrieval system