KEGG   Bacillus subtilis subsp. subtilis 168: BSU15280
Entry
BSU15280          CDS       T00010                                 

Gene name
ftsA
Definition
(RefSeq) cell division protein FtsA
  KO
K03590  cell division protein FtsA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15280 (ftsA)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU15280 (ftsA)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU15280 (ftsA)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   BSU15280 (ftsA)
SSDB
Motif
Pfam: FtsA SHS2_FTSA MreB_Mbl PilM_2 EutA Ppx-GppA DUF3484 HIN
Other DBs
NCBI-GeneID: 936145
NCBI-ProteinID: NP_389411
Pasteur: BG10231
BSORF: BG10231
UniProt: P28264
Position
1596474..1597796
AA seq 440 aa
MNNNELYVSLDIGTSNTKVIVGEMTDDSLNIIGVGNVPSEGLKKGSIVDIDETVHSIRKA
FDQAERMVGFPLRKAIVGVNGNYINIQDTNGVVAVSSENKEIQVEDVRRVMEAAQVVSVP
HEQLIVDVIPKQFIVDGRDEITDPKKMLGVRLEVEGTLITGSKTILHNLLRCVERAGIEI
TDICLQPLAAGSAALSKDEKNLGVALIDIGGGSTTIAVFQNGHLTSTRVIPLGGENITKD
ISIGLRTSTEEAERVKKQLGHAYYDEASEDEIFEVTVIGTNQKQTFTQQEAANIIEARVE
EILEIVSEELRSMGITDLPGGFVLTGGQAAMPGVMSLAQDVLQNNVRVASPNYIGVRDPQ
YMTGVGLIQFACRNARIQGRKIGFKMPEEAIQEIAVSSSEEQEQHHHQNEVQQRPKGKQK
TQAEHNKQSKMKKLLSMFWE
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgaacaacaatgaactttacgtcagtcttgacatcggtacgtccaatacaaaagtgatc
gtcggagaaatgacagatgattcccttaatattatcggtgtgggaaatgtaccgtctgaa
gggttgaaaaaaggctcaatcgttgatatagatgagaccgttcattctataagaaaagcg
tttgaccaagctgaaagaatggtaggttttccgcttagaaaagctattgtcggcgttaat
ggaaattatatcaatattcaagatacaaacggtgttgtagcagtttccagtgaaaataaa
gaaattcaggttgaagatgtacgccgtgtcatggaggcggcacaggttgtttccgtaccg
catgaacagctgattgttgacgtcattcctaaacagtttatcgtagatggaagagatgaa
atcaccgacccgaaaaaaatgctgggtgtgcgtttagaagtagagggcaccttgatcacc
ggttcaaaaacaatcttacataacttactccgctgcgttgaaagagctggtattgaaata
actgatatttgccttcagccgctggcagccggttctgctgcattatcaaaggacgagaaa
aaccttggtgtggctctcattgatatagggggagggtcaacaaccattgccgtattccag
aacggacatctcacttctacccgtgtcattcctctcggaggcgaaaatatcaccaaagat
atctccatcggattgagaacgtcaacagaagaagcagaacgcgtgaaaaagcaacttgga
catgcctactatgacgaagcctcggaagatgaaatatttgaggtaaccgttataggcacc
aatcaaaaacaaacatttacacagcaagaagcagcgaatatcattgaagcgagagtagag
gaaattcttgaaattgtttcagaagagcttcgcagtatgggaattaccgatctgccggga
ggcttcgtgctgacaggaggacaagcagctatgccgggtgtcatgtctttggcacaggat
gtgctgcaaaacaatgtcagagtggcaagcccgaattatatcggtgtaagagatcctcaa
tatatgacgggagtgggcctgatccaattcgcctgccggaatgcaagaatccaaggcaga
aaaataggctttaagatgcctgaagaagcgatacaggaaatcgcagtctcatcatctgag
gaacaagagcagcatcatcaccaaaatgaggtgcagcagcggccaaaaggaaaacaaaaa
acacaagccgaacataataaacagagcaaaatgaaaaaactattaagcatgttttgggaa
tag

DBGET integrated database retrieval system