KEGG   Bacillus subtilis subsp. subtilis 168: BSU15290
Entry
BSU15290          CDS       T00010                                 

Symbol
ftsZ
Name
(RefSeq) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU15290 (ftsZ)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bsu04812]
    BSU15290 (ftsZ)
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU15290 (ftsZ)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU15290 (ftsZ)
Cytoskeleton proteins [BR:bsu04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   BSU15290 (ftsZ)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BSU15290 (ftsZ)
SSDB
Motif
Pfam: Tubulin FtsZ_C NAD_binding_10 Tubulin_2 DUF4623
Other DBs
NCBI-GeneID: 935971
NCBI-ProteinID: NP_389412
Pasteur: BG10232
BSORF: BG10232
UniProt: P17865 A0A6M3ZFU4
Structure
PDB: 

Position
1597832..1598980
AA seq 382 aa
MLEFETNIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQ
IGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQI
AKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPML
EAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEA
AKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINE
NLKDEIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKREPKREEPQQQNTVSRH
TSQPADDTLDIPTFLRNRNKRG
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgttggagttcgaaacaaacatagacggcttagcatcaattaaagtaatcggagtagga
ggcggcggtaacaacgccgttaaccgaatgattgaaaatgaagtgcaaggagtagagtat
atcgcggtaaacacggacgctcaagctcttaacctgtcaaaagcagaagtgaaaatgcaa
atcggcgcaaagctgactagaggattgggagcaggtgcgaatccggaagtcgggaaaaaa
gccgctgaagaaagcaaagagcagattgaagaagcacttaaaggtgctgacatggtattc
gtgacagctggtatgggcggcggaacaggaacaggtgccgcaccggttatcgcacaaatc
gcgaaagacttaggcgcattaacagtcggcgttgtgacaagaccgtttaccttcgaagga
cgcaaaagacagcttcaggctgcaggcggaatctcggcaatgaaagaagcggtggataca
ctgatcgtgatcccgaacgaccgtatccttgaaattgttgataaaaacacaccgatgctt
gaagcattccgcgaagcggataacgtacttcgccaaggggttcaaggtatttctgacttg
attgctacacctggtcttatcaaccttgactttgctgatgtgaaaacaatcatgtcaaac
aaaggatctgctttgatgggtatcggtattgctactggggaaaatcgcgcggcagaggca
gcaaaaaaagcaatttccagcccgcttcttgaagcggccattgacggtgcgcaaggcgtc
ctcatgaacatcactggaggaacaaacctcagcctatatgaggttcaggaagcagcagac
attgtcgcttcggcgtctgatcaagacgtaaacatgattttcggttctgttattaatgaa
aatctaaaagatgagattgtggtgacagtgattgcaaccggctttatcgaacaagagaag
gacgtgacgaagcctcagcgtccaagcttaaatcaaagcatcaaaacacacaatcaaagt
gttccgaagcgtgagccaaaacgtgaggaacctcagcagcagaacacagtaagccgtcat
acttcacagccggctgatgatacgcttgacatcccgacattcttaagaaaccgtaataaa
cgcggctaa

DBGET integrated database retrieval system