KEGG   Bacillus subtilis subsp. subtilis 168: BSU15310
Entry
BSU15310          CDS       T00010                                 

Gene name
spoIIGA
Definition
(RefSeq) sporulation sigma-E factor-processing peptidase
  KO
K06383  stage II sporulation protein GA (sporulation sigma-E factor processing peptidase) [EC:3.4.23.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU15310 (spoIIGA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     BSU15310 (spoIIGA)
Peptidases and inhibitors [BR:bsu01002]
 Aspartic peptidases
  Family A36
   BSU15310 (spoIIGA)
Motif
Pfam: Peptidase_U4
Other DBs
NCBI-GeneID: 939984
NCBI-ProteinID: NP_389414
Pasteur: BG10234
BSORF: BG10234
UniProt: P13801 A0A6M3ZM43
Position
1603779..1604708
AA seq 309 aa
MKIYLDVIWLLNFCFDALLLLLTAFILKRHVKKRRLVGGAFIGSSIVLLMFTPFSPIVEH
PAGKLAFSVVIVVVTFGFKRFRFFFQNLFSFYFATFLMGGGIIGAHSLLQSNSIVQNGVM
ITNQTGFGDPISWLFIVGGFPALWFFSKRRIEDIETKNIQYEERVSVQADLGSQTLHVRG
LIDSGNQLYDPLTKTPVMIIYIDKLEPIFGTAETMIIRNTDPLEAIEQLDDSFRFLDKMR
LIPYRGVGQQNQFLLCVKPDHVTIMTKEEMISADKCLIGISTTKLSADGEFDAIIHPKML
SGKAVKHVS
NT seq 930 nt   +upstreamnt  +downstreamnt
gtgaaaatctatttagatgtcatttggctgttaaacttttgttttgatgcacttttgctt
ttgctcacggcatttattttaaaacggcatgtaaaaaaaagaagactggtaggcggagcg
ttcatcggttccagtattgtccttttgatgtttactcctttttcgccgattgttgaacat
ccggctgggaagctagctttttcagttgtgattgtggtggtgacatttggctttaaaaga
tttcggtttttctttcaaaatttgttttccttttattttgccacttttttaatgggggga
ggaattatcggagcccattctttgctgcagtcaaattctattgttcaaaacggtgtcatg
attaccaatcaaacagggtttggagacccgatcagctggttgtttattgttggtggcttt
ccagcattatggtttttttctaaaagaagaattgaagatattgaaacaaaaaacattcaa
tatgaggaacgagtcagcgtgcaggcagatttgggcagccaaacacttcatgtcagaggc
ctgattgattccggtaaccagctgtacgatcctcttacaaaaacaccggtaatgatcatt
tacattgataaactggagccgattttcggaacagccgaaacgatgatcattcgaaacaca
gacccattggaagccatcgaacagctcgatgattcctttcgctttttagataaaatgagg
ttgattccatacaggggagttggtcagcaaaatcaatttttattatgcgttaaaccggat
cacgtaacgattatgacaaaagaagaaatgatttctgcagataaatgtttaatcggtatc
agcacaacaaagctgtcggcagatggagagtttgacgcgattattcatccgaaaatgctt
tcgggcaaggctgtcaaacacgtttcataa

DBGET integrated database retrieval system