KEGG   Bacillus subtilis subsp. subtilis 168: BSU15340
Entry
BSU15340          CDS       T00010                                 

Symbol
ylmA
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU15340 (ylmA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    BSU15340 (ylmA)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_22 Thymidylate_kin cobW AAA_23 AAA_16 AAA_29 RsgA_GTPase
Other DBs
NCBI-GeneID: 940012
NCBI-ProteinID: NP_389417
Pasteur: BG13370
BSORF: BG13370
UniProt: O31723 A0A6M3ZAJ6
Position
1606560..1607354
AA seq 264 aa
MILQLDNVSLKRNGKWILKDIHWKVEEKENWVLYGLNGAGKTALLNMLCSYYFPTSGEMQ
VLGHEFGKTELGEKLRRKIGLVSAALQQKLYPADSAFEIALSGAYASIGLYETPSKETRE
KAIGLLEDLGAIEYADRRYETLSQGEKQRALIARALMADPELLILDEPVTGLDFIAREKL
LDTITYIANKENAPSILYVTHHAEEILPVFDKALLLKQGEVFGSGEIKEMLTDQILSAFF
DTPIHVLWNQDRPFLTRAEPITNA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgattttgcagcttgacaatgtctcactaaaacggaatgggaaatggatactgaaagat
attcattggaaggtggaagaaaaggaaaattgggtgctttacggcctaaatggcgccggg
aagacagcgctgttaaatatgctttgctcatattattttccaacatcaggcgagatgcag
gtgctcggccatgaatttggcaaaacagagcttggggaaaagctcagacgtaaaattggc
ctcgtctcagcagctcttcagcaaaaattgtatccggcagattcagcttttgaaattgct
ttgagcggagcttacgcttcgattgggttatatgaaacgccaagtaaggaaaccagggaa
aaagcgataggtttgttagaggacttgggagcaattgaatatgccgatcgccgctatgaa
accctttctcaaggggaaaaacaaagagcattgattgctagagcactaatggccgatccg
gagctgctgatactggatgaaccagtcacaggactggattttattgcccgggaaaagctg
ttagatacgattacatacattgcaaacaaagaaaatgcaccatctatcctttatgtgact
catcatgctgaagaaattttgcctgtctttgataaagcccttttattaaaacagggagag
gtttttggatccggagaaataaaggaaatgcttactgatcaaatactttccgcttttttt
gatacgccaatccatgtattatggaatcaggatcggccgtttttaacaagagctgagccg
ataacgaatgcctga

DBGET integrated database retrieval system